KEGG   Falco cherrug (Saker falcon): 102057595
Entry
102057595         CDS       T02911                                 

Gene name
CTNND1
Definition
(RefSeq) catenin delta-1 isoform X1
  KO
K05690  catenin (cadherin-associated protein), delta 1
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:fch00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102057595 (CTNND1)
SSDB
Motif
Pfam: Arm HYPK_UBA Ebp2
Other DBs
NCBI-GeneID: 102057595
NCBI-ProteinID: XP_027669297
LinkDB
Position
Unknown
AA seq 949 aa
MDDSEVESTASILASVKEQEAQFEKLTRALEEERRHVSAQLERVRVSPQDAGPGLANGTL
TRRHQNGRFLGDADLERQKYPDLKLNGPQDHSHLLYSTIPRMQDPGQIVEETYTMEEDPE
GAMSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQQVPVGPDGLPLETSPVPSNYVQTM
DRNFRKNGNGGPGSYISQPGTATLPRNYHYPDGYGRTYEDGYPGSDHSYGSLSRVTRIDE
RYRPSMDTYRAPSRQDIYGPQPQVRVGGSNMDLNHFHPEPYGLEDDQRSVGFEDVDYGLM
SDYGTARRAGTPSDPRRRLRSYEDMLVDEVAPDRYYWAPLAQHERGSLASLDSLRKGGLA
PGNWRQPELPEVIAMLSFRLDAVKSNAAAYLQHLCYRNDKVKTEVRKXXXXXXXXXXXCG
ALKNISFGKDQDNKIAIKNCDGVPALVRLLRKAHDMDLTEVITGTLWNLSSHDSIKMAIV
DHALHALTDEVVIPRSGWEREPNEDSKPRHIEWESVLTNTAGCLRNVSSERSEARRKLRE
CDGLVDALIYIVQSEIGQKDLDSKLVENCVCLLRNLSYQVHREIPHAERYQETPLAPANN
TGPHAASCFGAKKGKDEWFSRGKKLPEDSGVDAVDFPKRTVPAKGYELLFQPEVVRIYIS
LLKESKTPAILEASAGAIQNLCAGSWTYGRYIRSALRQEKGLSAIADLLTHDSERVVKAA
SGALRNLAVDLRNKELIGKHAIPNLVKNLPGGQQTPAKNLSEDTVVSILNTVNEVIVDNL
EAAKKLRETQGIEKLVLINKSGNRSEREVRAAALVLQTVWGYKELRKPLEKEGWKKSDFQ
VNLSNVSRTQGGNSFDDSTLPLIDRNQKSDKKSSREEIQMSNMGPDNYSTLNERDHSRTL
DRSGDLGDMEPVKAAPLMQEEGQESPPEVEEENAVCSPVSVCPAVSCPI
NT seq 2850 nt   +upstreamnt  +downstreamnt
atggacgactcagaagtggagtcgaccgccagcatccttgcttctgtcaaggagcaggag
gcacagttcgagaagctgacccgggcgcttgaggaggaacggcgccatgtctcagcccaa
ctggaacgagtccgggtctccccacaggacgccggcccgggcttggccaacggcacactc
acccggcggcaccagaatggccgtttcttgggcgatgctgacctggagaggcagaaatat
ccagatctgaagctcaacgggccacaggaccacagccacctcttgtacagcacaatcccc
aggatgcaggacccgggccaaattgtggaggagacttacactatggaggaggacccagaa
ggggccatgtctgttgtgtctgtggagacatcagatgatgggacaacgcgacgtacagag
accacggtgaagaaagtggtgaagactgtgaccacccgaacagtgcagcaggtgccggtg
gggcctgatgggttacctttggagacctcccctgtccccagcaactacgtccagaccatg
gacaggaacttccgcaagaatggcaatgggggccccggcagctacataagccagccaggc
acggccaccctccctcgtaactaccactaccctgatggctatggccgcacctacgaggat
ggctacccgggcagtgatcacagctacggcagcctgtcccgtgtcacccgcattgatgag
cgctaccgcccttccatggacacctaccgggcccccagccgccaggacatctatggccct
cagcctcaagtgcgtgttgggggcagcaacatggacctcaaccatttccaccctgagccc
tatggcctggaggatgaccagcgcagcgtgggctttgaagatgtggactatgggcttatg
tctgactatggcacggccaggcgggcagggaccccgtctgatcctcggcggcggctcagg
agttatgaagacatgctggtggatgaagtggcccctgaccggtactactgggcccctctg
gctcagcacgagcggggtagcctggctagcctggacagcctgcggaagggaggtctggcc
ccgggtaactggcgccagccggagctgccggaggtgatagccatgctgagcttccgactg
gatgctgtcaagtccaacgcggctgcctacctgcagcacctctgctaccgtaatgacaag
gtgaagacggaggtgcgcaagnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnncctgtgga
gccctcaagaacatttcctttggcaaggaccaagacaataagattgccatcaagaactgc
gatggggtgcctgctctggtccgcctgttgcggaaggcccatgacatggacctcacggag
gtcatcacaggaacactgtggaacctgtcctcgcacgactccatcaagatggccattgtg
gatcatgcactacatgctctgaccgacgaggttgtcattccccgctcgggctgggagcgg
gaacccaatgaggactcaaaaccccgccatattgagtgggagtcagtgctcaccaacacc
gctggctgtcttaggaacgtgagctcagaacggagcgaggcccgtcggaagctgcgggaa
tgtgatgggctggtagatgccctgatctacatcgtccagtctgagattggccagaaggac
ttggacagcaagctggtggagaactgtgtgtgcctgctgagaaacttgtcctaccaagtc
catcgtgagatcccccatgctgagcgttaccaggagacacctctggcccctgccaacaac
actgggccccatgctgcaagctgctttggtgccaagaagggaaaagacgaatggttctcc
agaggtaaaaagctcccagaagactctggtgtcgatgcagtggattttcccaaaagaaca
gttccagccaaaggctatgagctcctcttccagccagaagtggtccggatatacatctcc
ctcctaaaagaaagcaagactccagccatcctagaggcttcggcaggagccattcagaac
ctgtgtgctggcagctggacgtacggccggtacatccgctcagcgctgcgccaggagaag
ggactctctgccatcgccgacctcctgacccacgacagcgagcgagtggtgaaagcagcg
tctggagccctgcgcaacctggctgttgacttgcgtaacaaagagctgataggtaaacat
gccatccccaacctagtgaagaacctgcctggaggccagcagaccccagccaaaaacctc
tctgaggacacagtggtgtcaatcctcaacacagtcaatgaagtaattgtagacaacctt
gaggctgccaagaagctgcgggaaacacagggtattgagaagttggtgctgatcaacaaa
tctgggaaccgctcagagagagaagtccgagcagctgctctagtcttgcagacagtttgg
ggatataaagagctgcggaagccacttgagaaggaaggctggaagaagtcagatttccag
gtgaacctgagcaatgtctctcggacccagggaggcaactcatttgatgacagcaccttg
cctctcatcgacaggaaccaaaaatccgacaagaaatcctcccgggaggagatccagatg
agcaacatgggaccagacaactattccacactcaatgagagggaccacagcaggacactg
gaccgatctggtgacctcggagatatggagccagtgaaggcagcaccattgatgcaggaa
gaggggcaggaatcgccacctgaggtggaggaggagaatgctgtgtgttcccctgtgtcg
gtatgtcccgcagtgtcctgcccaatctga

DBGET integrated database retrieval system