KEGG   Falco cherrug (Saker falcon): 102057768Help
Entry
102057768         CDS       T02911                                 

Gene name
SOD1
Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:fch00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102057768 (SOD1)
Enzymes [BR:fch01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     102057768 (SOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 102057768
NCBI-ProteinID: XP_027671541
LinkDB All DBs
Position
Unknown
AA seq 143 aa AA seqDB search
RYSHFGDDKLFLLKGNGPVKITGRISGLTDGDHGFHVHEFGDNTNGCTSAGSHFNPEGKQ
HGGPKDAERHVGDLGNVTAKGGVADVEIQDSIVSLSGPYSIIGRTMVVHEKCDDLGRGGD
NESKLTGNAGPRLACGVIGIAKS
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
cgctacagtcattttggtgatgataaattatttctgttaaagggtaatggaccagtaaaa
attactggaagaatcagtggcttgactgatggagaccatggcttccatgtccatgaattt
ggtgacaatacaaatgggtgtaccagtgcaggttctcacttcaatcctgaaggcaagcag
catggtggaccaaaggatgcagaaaggcacgtgggagaccttggcaatgtgactgctaaa
ggaggagtggcagatgtggaaatacaagattccattgtttctcttagcggaccatatagc
atcatcggacgtaccatggtggtccatgaaaaatgtgatgacctgggtagagggggagat
aatgagagcaaattaactggaaatgctggacctcgtttagcttgtggtgtaattggaata
gcgaagagctaa

DBGET integrated database retrieval system