KEGG   Falco cherrug (Saker falcon): 102057970
Entry
102057970         CDS       T02911                                 

Gene name
FER
Definition
(RefSeq) tyrosine-protein kinase Fer
  KO
K08889  tyrosine-protein kinase Fer [EC:2.7.10.2]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:fch00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102057970 (FER)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fch01001]
    102057970 (FER)
   01009 Protein phosphatases and associated proteins [BR:fch01009]
    102057970 (FER)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fch04131]
    102057970 (FER)
Enzymes [BR:fch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102057970 (FER)
Protein kinases [BR:fch01001]
 Non-receptor tyrosine kinases
  FES family
   102057970 (FER)
Protein phosphatases and associated proteins [BR:fch01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102057970 (FER)
Membrane trafficking [BR:fch04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   F-BAR proteins
    102057970 (FER)
SSDB
Motif
Pfam: FCH SH2
Other DBs
NCBI-GeneID: 102057970
NCBI-ProteinID: XP_027657289
LinkDB
Position
Unknown
AA seq 494 aa
MGFGGDLKYSHDALLKLQDWELRLLETVKKFMVMRVKSDKEYASTLQNLCNQVDKESTCQ
LDYISNVSKSWLLVVQQTEQLSKIMKTHAEDLNSGPLHRLTMMIKDKQQVKKSFVGVHQQ
IEAEMYKVTKTELEKLKSSYRQLIKEVNSAKEKYKEAVAKGKETEKAKDRCDKATMKLHM
LHNQYVLALKGAQLHQHQYYDTTLPLLLDSLQKMQEEMIKALKGILDEYSQITSLVTEEI
VNVHKEIQTSVEQIDPNSEYNDFIDTHRSSEVVEQEIEFDTSLLEENENLQANEIMWNNL
TAESLQVTLKTVIEELIQTQQTLLSKEELVLELEKKIEESSKTCEKKSDIVLLLSQKQAL
EELKQTVQQLRCSEAKFAAQKELLQQKVQENDGKEPPPVVNYEEDARSVTSMDKKDKVSR
FDTIRHSIAGIIRSPKSMLGSSSFFDVISTTEKPLAEQDWYHGAIPRIEAQELLKQQGDF
LVRESHGKPESVSF
NT seq 1485 nt   +upstreamnt  +downstreamnt
atggggtttggaggtgacctgaagtattctcatgatgctttattaaaactacaagactgg
gaactacgactgctggaaacggtgaagaaatttatggtaatgcgagtaaaaagcgataag
gagtatgcctcaactttacagaatctttgtaatcaagtagataaagagagcacgtgtcaa
ttggattatatcagcaatgtgtccaagtcttggttgctcgtggtacagcaaacagaacag
ctgagcaaaataatgaagacacatgcagaagatcttaattccgggcctttgcataggctt
acaatgatgatcaaagataagcagcaagttaagaagagtttcgtaggtgttcatcaacaa
atagaagcagagatgtacaaggtcacaaagacagaactagagaaactaaaatctagctat
agacaactaataaaagaagtaaattctgccaaagaaaaatataaagaagctgtggctaaa
ggaaaagagactgaaaaagccaaagatcggtgtgataaagccactatgaagcttcatatg
ttgcataatcagtatgtgttggcactgaaaggagcacagttacatcagcaccagtattat
gatactacgcttcctctgttacttgattcactacagaagatgcaagaagaaatgattaaa
gccctaaaaggaatcttggatgagtatagccagatcactagtcttgtaacagaagagatt
gtgaatgtccataaagagatccagacctcagttgaacagatagatcctaactctgagtat
aatgacttcatagatactcacaggtcatcagaagttgttgaacaagaaatagagtttgat
acgtctttattagaagaaaatgaaaaccttcaagctaatgagatcatgtggaataatcta
acagcagaaagtttacaagtcacgttaaaaacagtaatagaagaactgattcagacacaa
caaacccttttgagcaaagaggaacttgtgttggaactggagaaaaagatagaagagtcc
tctaagacttgtgaaaagaagtctgatattgtactcttgctaagccaaaagcaagcactg
gaagaacttaagcaaacagttcagcaattaagatgctcagaggcaaaatttgcagcccag
aaagaactactgcaacaaaaggtccaagagaatgatgggaaggagccaccacctgtagtg
aactatgaagaagatgctagatcagtgacttctatggacaagaaggacaaagtctcaaga
tttgacactatacgtcattccatagctggaattataaggtctccaaaatccatgttgggg
tcatcatcgttctttgatgtaatttcaaccactgagaaaccattggctgagcaagactgg
tatcatggtgcaattccaagaatagaagcccaggagctgttaaaacagcaaggagacttc
ttggtgcgagagagccacgggaaacctgaatcagtatcgttttga

DBGET integrated database retrieval system