KEGG   Falco cherrug (Saker falcon): 102057999
Entry
102057999         CDS       T02911                                 

Gene name
VCL
Definition
(RefSeq) vinculin isoform X3
  KO
K05700  vinculin
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04510  Focal adhesion
fch04520  Adherens junction
fch04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:fch00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102057999 (VCL)
   04520 Adherens junction
    102057999 (VCL)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102057999 (VCL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fch04812]
    102057999 (VCL)
   04147 Exosome [BR:fch04147]
    102057999 (VCL)
Cytoskeleton proteins [BR:fch04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     102057999 (VCL)
Exosome [BR:fch04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102057999 (VCL)
SSDB
Motif
Pfam: Vinculin CARD
Other DBs
NCBI-GeneID: 102057999
NCBI-ProteinID: XP_005443910
LinkDB
Position
Unknown
AA seq 1136 aa
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVSAVQAAVSNLVRVGKE
TVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTS
DLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQ
ELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKSQGIEEALKNRNFTVEKMSAE
INEIIRVLQLTSWDEDAWASKDTEAMKRALALIDSKMNQAKGWLRDPNAPPGDVGEQAIR
QILDEAGKAGELCAGKERREILGTCKTLGQMTDQLADLRARGQGATPMAMQKAQQVSQGL
DLLTAKVENAARKLEAMTNSKQAIAKKIDAAQNWLADPNGGSEGEECIRGIMAEARKVAE
LCEEPKERDDILRSLGEISALTAKLSDLRRHGKGDSPEARALAKQIATSLQNLQSKTNRA
VANTRPVKAAVHLEGKIEQAQRWIDNPTVADRGVGQAAIRGLVAEGRRLANVMMGPYRQD
LLAKCDRVDQLAAQLADLAARGEGESPQARAIAAQLQDSLKDLKTRMQEAMTQEVSDIFS
DTTTPIKLLAVAATAPSDAPNRDEVFDERAANFENHAARLGATAEKAAAVGTANKTTVEG
IQATVKSARELTPQVVSAARILLRNPGNQAAYEHFETMKNQWIDNVEKMTGLVDEAIDTK
SLLDASEEAIKKDLDKCKVAMANMQPQMLVAGATSIARRANRILLVAKREVENSEDPKFR
EAVKAASDELSKTISPMVMDAKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQPQEP
DFPPPPPDLEQLHLTDELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQKAGEAINQPMMM
AARQLHDEARKWSSKPDVTVINEAAEAGVDIAEEDDADVEFTLPSDIEDDYEPELLLMPT
NQPVNQPILAAAQSLHREATKWSSKGNDIIAAAKRMALLMAEMSRLVRGGSGNKRALIQC
AKDIAKASDEVTRLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLKILSTVKATMLGRTN
ISDEESEQATEMLVHNAQNLMQSVKETVREAEAASIKIRTDAGFTLRWVRKTPWYQ
NT seq 3411 nt   +upstreamnt  +downstreamnt
atgcccgtcttccacacacgcaccatcgagagcatcctggagccggtggcccagcagatc
tcccacctggtcattatgcatgaggagggagaggtggacggcaaggccattccggacctc
accgcccccgtgtcggccgtgcaggccgctgtcagcaacctggtgcgggttggaaaagag
actgtgcagacaacagaagaccagatcttgaaaagggatatgccaccagcatttatcaaa
gtggagaacgcctgcaccaaacttgttcgggcagcccagatgctgcaagcagatccttat
tcagtaccagctcgtgactatctaattgatggatcaagaggcattctttctggaacgtca
gacttacttttgacatttgatgaagcagaggtccgtaaaatcatccgtgtctgcaaagga
atattggaatatctgactgtggcggaagtagtagagactatggaggatttggtgacatac
acaaagaatctagggccaggaatgacaaagatggccaaaatgattgatgagagacaacag
gaattaactcatcaggaacacagggttatgctggtaaactctatgaataccgtgaaggag
ctattgccagtacttatttcagctatgaagatttttgtaaccacgaaaaattctaaaagc
cagggaatagaagaggccttgaaaaaccgcaattttacagtagagaaaatgagtgctgag
ataaatgaaataatccgtgtattacaactcacttcctgggatgaagatgcctgggcaagc
aaggacactgaagccatgaaaagagctttagccttaatagattcaaagatgaatcaggca
aaaggttggctgagagatccgaatgcacctccaggtgatgttggtgagcaggcaatcagg
cagatccttgatgaagcgggaaaagcaggagaactgtgtgcaggcaaagaacgcagagag
attctgggaacatgcaaaactctgggccagatgactgatcaactggcagacctccgagca
agagggcagggtgcgacacccatggctatgcagaaagcacagcaggtctctcaaggtctg
gatttgctcactgcaaaagtggagaatgcagcccgcaaactggaggccatgacgaactcg
aagcaggcaattgctaagaagattgatgctgctcagaattggcttgcagaccctaatggg
ggcagcgaaggagaagaatgtattcggggaattatggctgaagcgaggaaagtcgcagaa
ttatgtgaggagcctaaagaaagagatgatattcttcgttccttgggtgaaatctctgct
ttgacagctaagctgtcagatctgcgacgacatgggaaaggtgactctcctgaggcccgt
gcattggctaagcaaatagctacatcacttcagaatttacagtccaaaacaaacagggct
gtagcaaatactaggccagttaaagcagctgtccatttggagggaaagattgagcaagct
caaaggtggatagacaatcctacagttgctgatcggggagtaggccaggcagcaattcgg
ggtctggttgcagaaggccgtcgtttagccaatgtcatgatgggaccctatcgtcaagat
ctgcttgccaaatgtgaccgtgtagaccaactggctgcccagctggctgacctcgcggcc
agaggggagggagaatcccctcaggccagggcgattgctgctcagcttcaggactcgctg
aaggaccttaaaacacggatgcaagaggcaatgacccaggaggtttctgacatttttagt
gacaccacaactcctattaaattgttagcagtagcagccactgctccctctgatgctccc
aatagagatgaggtgtttgatgaaagagcagcaaactttgaaaatcatgctgctagactg
ggagctacagcagaaaaagcagctgcagttggaactgcgaataaaactactgtggagggc
attcaggcgacagtgaaatcggcaagggaacttaccccgcaggtagtatcagctgctcgt
atcctcctgagaaatcctggaaatcaagctgcctatgaacattttgagaccatgaaaaac
caatggattgataatgtagaaaaaatgacagggttagtggatgaagccattgatactaaa
tctctgttggatgcatcagaagaggctattaagaaagatcttgataaatgtaaagttgca
atggccaacatgcaacctcagatgctggtagctggtgccaccagcattgccagacgagcg
aaccgcatcctactggtagcaaaacgggaggttgaaaattcagaagatcctaaattccgg
gaggctgttaaagcagcctctgatgagctaagcaaaactatatcaccgatggtaatggat
gctaaagctgtggcaggaaacatttctgatcctggtttgcagaagagtttcttggattct
ggatacagaattctgggagctgtggccaaagtcagagaagccttccagcctcaggagcca
gattttccccctcctcctcctgaccttgagcagcttcatctgactgatgaactggctcct
ccaaaaccaccacttccagaaggtgaggttcccccacccagaccaccaccacctgaagaa
aaggatgaagagttcccagagcagaaagcaggagaagctattaatcagcccatgatgatg
gctgctaggcagctgcatgatgaagcccggaaatggtctagcaagcctgatgtgactgtg
attaatgaagcggctgaggctggtgtagatatagctgaggaggatgatgcagatgttgaa
ttcactctcccctctgacattgaagatgattacgagcctgagctgctgttaatgccaacc
aatcagcctgttaaccagcccattctggctgctgctcagtctctacatcgggaagcaacc
aagtggtctagtaagggtaatgacatcattgctgccgctaaacgaatggcgctgctaatg
gcagagatgtcgcgcctggtgagaggaggcagtggaaacaagcgcgcccttattcagtgc
gcgaaggatattgctaaggcgtcggatgaagtcactcgattagccaaagaggtggcaaag
cagtgcactgacaagcgcataagaacaaacctcttgcaggtctgtgagcgaatcccaacc
atcagcacacaactgaaaattctctccactgtcaaagctaccatgctgggcagaaccaac
atcagcgatgaagagtcggagcaggcaacggagatgttggttcataatgcccagaacctc
atgcagtctgtgaaggaaactgtgagagaagctgaagcagcgtccattaagataagaaca
gatgctggattcactcttcgctgggtcagaaagaccccttggtatcagtaa

DBGET integrated database retrieval system