KEGG   Falco cherrug (Saker falcon): 102058018Help
Entry
102058018         CDS       T02911                                 

Gene name
GCK
Definition
(RefSeq) glucokinase
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch00010  Glycolysis / Gluconeogenesis
fch00052  Galactose metabolism
fch00500  Starch and sucrose metabolism
fch00520  Amino sugar and nucleotide sugar metabolism
fch00524  Neomycin, kanamycin and gentamicin biosynthesis
fch01100  Metabolic pathways
fch01200  Carbon metabolism
fch04910  Insulin signaling pathway
Module
fch_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
fch_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102058018 (GCK)
   00052 Galactose metabolism
    102058018 (GCK)
   00500 Starch and sucrose metabolism
    102058018 (GCK)
   00520 Amino sugar and nucleotide sugar metabolism
    102058018 (GCK)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    102058018 (GCK)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102058018 (GCK)
Enzymes [BR:fch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     102058018 (GCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 102058018
NCBI-ProteinID: XP_005432492
LinkDB All DBs
Position
Un
AA seq 461 aa AA seqDB search
MPGINPGIASAFPILGLMPSVPLQVERILSEFRLKEEDLKKVMYRMQKEMDRGLKLETHE
EASVKMLPTYVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQWKVKTKHQMYSIP
EDAMTGTAEMLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGF
KASGAEGNNVVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDHRCEVGMIVGTGCN
ACYMEEMQNVELVEGNEGRMCVNTEWGAFGASGELDEFLLEYDRVVDETSLNPGQQLYEK
IIGGKYMGEIVRLVLLKLVDENLLFNGEASEKLKTRGTFETRFVSQIESDSDDRKQIYNI
LTAFELLPSGTDCDIVRMVCESVSTRAAQMCSAGLAGVINRMRESRSQETLKITVGVDGS
VYKLHPSFKDRFQRARSRAHLCRRLQNGLHDGAVRKDSGGS
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcctggcatcaatcccggcatcgccagcgcttttcccatcctggggctgatgccgtct
gtcccgctgcaggtggagcggatcctgtcagagttccggctgaaggaggaggacctgaag
aaggtgatgtaccggatgcaaaaagagatggaccgagggctaaagctggagacacatgag
gaagcctctgtcaaaatgctgcccacctatgtccgctccacacctgagggctcagaggtc
ggagatttcctgtcgctggacctcggcggcaccaatttccgtgtgatgctggtgaaagtg
ggcgagggggaggaagggcagtggaaggtgaaaacgaagcaccagatgtactctatccca
gaggatgccatgacagggacggctgagatgctctttgactacatctccgagtgtatctct
gatttcctggacaagcaccagatgaagcacaaaaagctgcccctgggcttcaccttctcc
ttccctgtgcggcacgaggacatcgacaagggcatcctcctgaactggaccaagggcttc
aaagcctccggcgcagaagggaacaatgtggttgggctcctgagagatgccatcaaacgg
cgaggggacttcgagatggacgtggtggcaatggtgaacgacacagtggccacaatgatc
tcctgctactatgaagatcaccggtgcgaggttgggatgattgtggggacaggctgcaat
gcctgctacatggaggagatgcagaacgtggagctggtggagggcaacgaggggaggatg
tgcgtcaacacggagtggggggccttcggcgcctcgggggagctggacgagttcctcctg
gagtacgaccgcgtggtggacgagacctcacttaaccccggtcagcaactctatgagaag
atcattggggggaagtacatgggggagatcgtccggctggtgctgctgaagctggtggat
gagaacctgctcttcaacggggaggcctctgagaagctcaagacccgtgggacctttgag
acccgcttcgtgtcacagatcgagagcgactctgatgaccgcaagcagatctacaacatc
ctgacggcctttgagctgctgccctcggggacggactgtgacatcgtgcggatggtctgc
gagagcgtctccacccgtgctgcccagatgtgctcggccgggctggctggcgtcatcaac
cgcatgcgggaaagccgcagccaggagaccctcaaaattaccgtgggcgttgacggctcc
gtctacaagctccatcccagcttcaaggaccgcttccagcgggcgcggagccgcgctcat
ctctgccgtcgcctgcaaaatggcctgcatgatggggcagtgagaaaggactcgggggga
agctga

DBGET integrated database retrieval system