KEGG   Falco cherrug (Saker falcon): 102058075
Entry
102058075         CDS       T02911                                 

Gene name
LPAR2
Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04080  Neuroactive ligand-receptor interaction
fch04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102058075 (LPAR2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102058075 (LPAR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fch04030]
    102058075 (LPAR2)
G protein-coupled receptors [BR:fch04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    102058075 (LPAR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 102058075
NCBI-ProteinID: XP_005435582
LinkDB
Position
Unknown
AA seq 361 aa
MLNVRFGCSGCAFRTAAMKHCFYNETVGFFYNNSRKELTTYWRTKDVLVVALGLTVSVIV
LLTNLLVITAIIINRRFHYPIYYLLGNLAAADLFAGIAYMFLMFHTGPRTAELSLKTWFI
RQSLLDTSLTASVVNLLAIAVERHQTVFTMQLHSKMSNQRVMILIFCIWVTALLLGLIPS
YGWHCLCALEKCSSMAPLYSRSYLTFWAISNLVIFLIMVVVYTHIFIYVKRKMTRMSKHT
SFHPRYKETMISLVKTVTIILSAFVICWTPGQVVLLLDGLGCKSCNVLAVEKYVLLLAEI
NSLINAIVYSYRDNEMRSTFRRILCFVCYRNSKYTPTAVKLNTTDRRTLSQNGHFTVDSS
I
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgctaaatgtcaggtttggatgcagtggttgtgctttcaggacagcagcgatgaagcac
tgtttttacaatgagaccgtggggttcttctacaacaacagccgcaaagagctgaccacg
tactggaggacgaaggatgtgctggtggttgccctgggcctgacggtgagtgtcattgtg
ctcctgaccaacctgctggtcatcactgccatcatcatcaaccggcgcttccactacccc
atctactacctgctggggaacctggcagcggccgacctctttgctggcattgcctacatg
tttctcatgttccacacggggccccggacagcagagctctccctgaagacctggttcatc
cgtcagagcttgctggacaccagtttgacagcctctgtggtgaacctgctggcaattgct
gtggaaaggcaccagaccgtgttcactatgcagttacacagcaaaatgtccaaccagcgc
gtgatgatcctcatcttctgtatttgggtcacggccctgctcctggggctcatcccgtcc
tacggctggcactgcctctgtgctctggagaagtgctccagcatggcaccgctctacagc
aggagctacctgaccttctgggccatctccaacctggtcatcttcctgatcatggtggtc
gtgtacacgcacatcttcatctacgtcaaaaggaagatgacacggatgtctaagcacact
agcttccacccccgctacaaggagaccatgatcagccttgtcaagacagtcactattatc
ctaagtgcttttgttatctgctggactccagggcaagttgtgctcctcctggatggcttg
ggctgcaagagctgcaacgttctagcggtggagaaatatgtccttttgctggcagagatc
aactcgttgataaacgcgatagtctactcttacagggacaacgagatgcgtagcaccttc
cggaggatcctctgctttgtctgttacaggaattccaaatacacccccacggcggtgaag
ttgaacaccacggaccgcagaacactttctcagaacgggcactttactgtggattcctct
atttag

DBGET integrated database retrieval system