KEGG   Falco cherrug (Saker falcon): 102058085Help
Entry
102058085         CDS       T02911                                 

Gene name
FADS2
Definition
(RefSeq) acyl-CoA 6-desaturase
  KO
K10226  acyl-CoA 6-desaturase (Delta-6 desaturase) [EC:1.14.19.3]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch00592  alpha-Linolenic acid metabolism
fch01040  Biosynthesis of unsaturated fatty acids
fch01100  Metabolic pathways
fch01212  Fatty acid metabolism
fch03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:fch00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    102058085 (FADS2)
   01040 Biosynthesis of unsaturated fatty acids
    102058085 (FADS2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    102058085 (FADS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:fch01004]
    102058085 (FADS2)
Enzymes [BR:fch01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.3  acyl-CoA 6-desaturase
     102058085 (FADS2)
Lipid biosynthesis proteins [BR:fch01004]
 Desaturase
  Front-end
   102058085 (FADS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase Cyt-b5 CHDNT
Motif
Other DBs
NCBI-GeneID: 102058085
NCBI-ProteinID: XP_014134786
LinkDB All DBs
Position
Unknown
AA seq 441 aa AA seqDB search
MGKGGEKGGEPEAQSRFYTWEEIPKHNLRTDGWLVIQRKVYNVTQWVNRHPGGYRVISHC
TGEDATDAFQAFHINPTLVQKFLKPLLIGELAPGEPSQGLDKNSQLVEDFRTLRKTAEDM
NLFRANPLFFSLYLGHIIAMEVLAWLMVSYFGTGWITTLILACILTTSQAQAGWLQHDFG
HLSVFKKSSWNHIVHKFIIGHLKGASANWWNHRHFQHHAKPNIFKKDPDVNMLHIFVLGD
IQPVEYGKKKLKYLPYNHQHEYFFLIFPPLLIPVYFQIQIISTMIRRRFWADLAWAISYY
MRYFITYIPFYGILGSLSLLTFVRFLESHWFVWVTQMNHIPMEIDCEKHRDWLSSQLAAT
CNIEQSFFNDWFTGHLNFQIEHHLFPTMPRHNFWKVKPLVKSLCAKHGVQYEEKPLGKAF
ADIIGSLKKSGDLWLDAYLHK
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggggaaagggggtgagaaaggaggggagccggaggcgcagagccgcttctatacctgg
gaggagataccgaagcacaacctgcggacggacggctggctggtgatacagcgaaaggtg
tataatgtcacccagtgggtaaacaggcacccggggggctaccgagtgatcagccactgc
accggcgaggatgccacggatgcattccaggccttccacatcaaccccaccttggttcag
aagtttctcaagccattacttattggagagcttgctccaggggaaccaagccagggccta
gataaaaactcccagctggtggaggatttccggaccctgaggaagacggcagaggacatg
aacttgttcagagcgaatcctttgtttttctcgctttacttgggccatattattgccatg
gaagtgttagcttggttaatggtttcatactttggtactggctggatcacaactctcatc
ctcgcctgcatccttacaacttcccaggctcaggcagggtggctgcaacatgattttggg
cacctctccgtctttaagaagtcttcttggaaccacatcgtccacaagtttatcattgga
cacctgaagggtgcctctgcaaactggtggaaccatcgtcacttccaacaccacgccaag
cccaacatattcaagaaggacccagatgtgaacatgctgcatatttttgtccttggagat
attcagcctgttgagtacggcaagaagaagctgaagtacctgccttacaaccaccagcac
gagtacttcttcctcatcttcccgcctctgctcatccctgtatatttccaaatccaaatt
atctcgaccatgatcaggcgcaggttctgggcggacctagcctgggccatcagctactac
atgcgctacttcatcacatacatcccgttctatggcattctgggatccctgtctctcctc
acttttgtcaggtttctggagagtcactggtttgtgtgggtcacccagatgaatcacatt
ccaatggaaatcgattgtgagaagcacagagactggcttagctctcagctggccgccact
tgcaatatcgagcagtcctttttcaacgactggttcaccgggcacctgaacttccaaatc
gagcaccacttgtttccaacaatgccacggcacaacttctggaaggttaagcctctggtg
aagtcattatgtgccaagcacggagtccaatatgaagagaagcctcttggaaaagccttc
gcagacatcattgggtccctaaagaaatctggcgatctatggctggacgcttacctccac
aagtga

DBGET integrated database retrieval system