KEGG   Falco cherrug (Saker falcon): 102058539Help
Entry
102058539         CDS       T02911                                 

Gene name
HDAC7
Definition
(RefSeq) histone deacetylase 7
  KO
K11408  histone deacetylase 7 [EC:3.5.1.98]
Organism
fch  Falco cherrug (Saker falcon)
Brite
KEGG Orthology (KO) [BR:fch00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fch03036]
    102058539 (HDAC7)
Enzymes [BR:fch01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102058539 (HDAC7)
Chromosome and associated proteins [BR:fch03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     102058539 (HDAC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 102058539
NCBI-ProteinID: XP_005436176
LinkDB All DBs
Position
Un
AA seq 986 aa AA seqDB search
MDLRIGQRVVKPGSDTTLLALKHTQQLQHQLFLASLHQQQVEQLTHQHVRVTMESPHREA
EPGQQEQELRQILNKDKSKRSAVASTVVKQKLAEVILKKQQAALERTSNPTPSAMPYRSL
EPLDPEGPSPPVLSTFLSPVPSTSLDPPEHFPLRKTASEPNLKVRCKPRKCLDRRKNPLM
RKESAPPSLKRRPPEAIDSSPSSSSTPVSGCSSPNDSLPAEHGALPAASSMAHETPLAQR
LMMQESSLAQFALQSATSLPAITLGLPATTSTRGESDLRPLSSLAHRVPVLNGPVLTGTH
SPMLIPAGLEQHEAASPLSPRLQPVIILEPSVTHTPLVAVPGLGTVPFSFTPSLISAERL
SLPGHHKPLGRTRSEPLPQNPKAIQQQLVYQQHHTQFLERLKQQTHLGKRMAKSSEKPRL
RQIPSSEDMEAEGTLPEAGAESSDPARAHVEPTRPGSIIKEPERMPKMMQPQEELVLQQA
YLWDSYQRVQQQLLKRQPLAESPVVPTIHAAHRPLSRAQSSPATATVSLPAQDTASKTLS
LPVQEQPAKPHFITGLVYDSVMLKHQCSCGDNSNHPEHAGRIQSIWSRLQERGLRSQCEC
LRGRKATLEELQCVHTERHVFLYGTNPLNRLKLDNGKLAGILSQRMFVMLPCGGVGVDSD
TIWNELHSSNAARWAAGSVTELAFRVATRELKNGFAVVRPPGHHADPSTAMGFCFFNSVA
IAARQLQQKGKLSKILIVDWDVHHGNGTQQIFYRDPDVLYISLHRHDDGNFFPGSGAADE
VGAGPGEGFNVNVAWTGGLDPPMGDPDYFYPHRTVVMPIAHEFSPDVVLVSAGFDAADGH
PPPLGGYKVSAKCFGYMTKQLMSLAGGAIVLALEGGHDLTAICDASEACVSALLGNELDP
LPEESMRQKPNPNAVRSLETVIQVQSKYWVAVQRFASKLGCSFLEAQHHEAEEVETVTAL
ASLSVAVMVEKRPQDELMEEEEPMNQ
NT seq 2961 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcggattgggcagcgtgtggtcaagcctggctctgacaccaccttgctggcc
ctgaagcacacgcagcagctgcagcaccagctcttcctcgccagtctgcaccagcagcaa
gtggagcagctcacccaccagcacgtgagggtgaccatggagtccccgcaccgtgaagct
gagcctgggcaacaggagcaggaactacggcagatcctcaacaaggacaagagcaagcga
agtgctgtggccagcacagtggtcaagcagaagctggctgaggtcattctgaagaaacag
caagcagctttggagaggaccagcaaccccaccccttcagccatgccgtacaggtctttg
gagcctctggatcctgaaggcccttcccctcctgtgctcagcaccttcctgtcccctgtc
cctagcacttctcttgacccgccagagcattttcctctgcggaagacagcatctgagccc
aacctgaaggtgcgttgcaagcccaggaagtgccttgaccgacgcaagaaccccctgatg
cggaaggagagtgctcccccctcactgaagaggcggccacctgaagcgattgactcctcc
ccaagcagtagcagcaccccagtgtctggctgcagctctcccaatgacagtctccccgct
gagcatggagccctccctgctgcctccagcatggcccacgagacacccctggcccagcgc
ctgatgatgcaggagagctcactggcccagtttgccctgcagagtgcaacctcccttccg
gctatcacgctgggattgccggctaccactagcaccaggggagagtcagatctccgcccc
ctctccagcttggcacaccgggtgcctgtgctgaacggacctgtcctcacgggcacacac
tcacccatgttaataccagctggcttggagcagcatgaagctgcgagccccttatcccct
cggctccagcccgtcatcatccttgagccctcggtcacccacactccactggtggcagtg
ccaggtctgggaacagtccccttctccttcaccccctcgctcatctctgcagagcgtctg
tcgctcccaggccaccataaaccgctgggcaggacccgctcagagcccctgccccagaac
cccaaggccatccagcagcaactggtgtaccagcagcatcacacccagttcctggagaga
ctcaagcagcagacacatctgggcaagcgcatggctaaatccagtgagaagccccgtcta
cggcagataccctcttctgaggacatggaggcggaggggacactcccagaggctggggct
gagagtagtgacccggcaagggcacatgtggagcccacacgaccagggagcatcataaag
gagcccgagaggatgccaaagatgatgcaacctcaagaggagcttgtcctacagcaggcc
tatctctgggattcctaccagcgcgtgcagcagcagctcctcaagcggcagcccttggcc
gagtctcccgttgtccccacgatccatgcagcgcacaggcccctctccagggcccagtca
tctcctgccaccgcaactgtctcccttcctgcccaggacacagcctccaagacactctcc
ctgcctgtgcaggagcagccagcaaagccacatttcataacagggctggtttatgactct
gtgatgctcaaacaccagtgctcctgtggtgacaacagcaaccacccagagcatgcaggc
aggatccagagcatctggtcccgtctgcaggagagaggcctgcgcagccagtgtgagtgt
ctgcggggacgcaaagccaccctggaagagctgcagtgtgtccataccgagcgccatgtc
ttcctctacggcactaaccccctcaaccgcctgaaactggacaacgggaagctggcaggg
atcctgtcgcagcggatgtttgtcatgctgccctgcggaggggtgggggtggacagtgat
accatctggaacgagctgcattcctccaacgctgcccgttgggctgcaggcagtgtcact
gagctggccttcagggtggccaccagggagctgaagaatggctttgctgtggtgcggcca
cctggacatcatgcggatccttccactgccatgggattctgtttctttaactcggtggcc
attgctgcaaggcagctgcagcagaaagggaaactcagcaagatcctcattgtggactgg
gatgttcaccacggcaatgggactcagcaaatcttctacagggaccctgatgttctctac
atctctttgcatcgtcatgatgatggcaacttcttccccggtagcggggctgctgatgag
gttggtgctggccccggtgagggatttaatgtcaacgtagcctggactggagggcttgac
ccgccgatgggtgaccctgactatttttacccacacaggacagtagtgatgccaatcgca
cacgaattctcccctgatgtggtgctggtgtcagctggcttcgatgcagcggatggccat
ccgccacccctgggcggctataaagtctctgctaaatgcttcggctacatgacaaagcag
ctgatgagcctggctggtggagccattgtccttgcactagaaggtggccatgaccttacg
gccatctgtgatgcatccgaggcctgtgtgtcagccttgctgggcaacgagctggaccct
ctcccagaagaaagcatgaggcagaaaccaaaccccaacgcagtgcgctccttggaaaca
gtgatccaggtccagagtaaatactgggtggctgtgcagcgctttgcctccaagctgggc
tgctccttcctggaggcgcagcaccacgaggcagaagaggtggagacagtcacagccttg
gcctccctctcggtggctgtgatggtggagaagaggccgcaagacgagctgatggaggaa
gaggagcccatgaaccagtga

DBGET integrated database retrieval system