KEGG   Falco cherrug (Saker falcon): 102058601
Entry
102058601         CDS       T02911                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: receptor-type tyrosine-protein phosphatase eta
  KO
K05698  receptor-type tyrosine-protein phosphatase eta [EC:3.1.3.48]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:fch00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102058601
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fch01009]
    102058601
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fch04090]
    102058601
Enzymes [BR:fch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     102058601
Protein phosphatases and associated proteins [BR:fch01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    102058601
CD molecules [BR:fch04090]
 Proteins
  102058601
SSDB
Motif
Pfam: Y_phosphatase PTP_tm fn3 GPI-anchored Pur_ac_phosph_N PTPlike_phytase Y_phosphatase3 DSPc DUF2627 Syndecan Y_phosphatase2
Other DBs
NCBI-GeneID: 102058601
NCBI-ProteinID: XP_027661120
LinkDB
Position
Unknown
AA seq 1170 aa
MSLSNRAISDRNNVTQPVPVLDIKAEYVGMTYISLTWEVNDTASNSYTYRIEVVNGTSIR
NLTSTVTTTNITDLMPGTLYNFTVIAVVNDDETEGEGLSIGLYTKPSPVQDLKAEYVGAE
KVSLTWAVNTTASSSYTYRIEVVSGTSVRNLTSTVTTTKITELFPGTMYSFTVFAVAADG
QTEGEAMSISLYTKPSPVQDLKAEYVGAEKVSLTWAVNTTASSSYTYRIEVVSGTSVRNL
TSTVTTTKITELFPGTMYSFTVFAVAADGQTEGEAMSISLYTKPSPVQDLKAEYVGAEKV
SLTWAVNTTASSSYTYRIEVVSGTFDRNLTSTVTTTKITELFPGTMYNFTVFAVAADGQT
EGEAMSISLYTKPSPVQDLKAEYVGAEKVSLTWAVNTTASSSYTYRIEVVSGTXXXXXXX
XXXXXXXXXXXXXXXXQMYNFPVFPVAAGGQTEGEAMSISLYTKPSPVQDLKAEYVGAEK
VSLTWAVNTTASSSYTYRIEVVSGTSVRSLSSNVTEVEITELFPGTMYSFTVFAVAADGQ
TEGEAMSISLYTIPAVVNSFHCEPVAKQSSLMLKWECPSGNNSGFKIKIFNDTWEKEEWA
PSCMREGSEETFRTLSLDYFRTYVVTIATLSNSSESRPVQQMCNTSITDPPAPSKAPLVK
AVSHSSLSVEFSDFESVNGPLKAYAVMITTEEQGCGSLKSKLNNTYKDFKKRTTVTYVTY
VIDIEQAKSPSFRSQNGTNIIHVGKGNTMYAYENGPLIPLHSYRASIAGFTNITFTMANI
IVGEDSYVSFSPCSEAVLLPQDPGVIAGAVIGCLLAILAVVSIGGFIFWRRRRKDKRNTE
VSFSPIKIKKSKIIKVENFESYFKKQQADSNCGFAEEYEELKSAGVHQPKFAAELAENRG
KNRYNNVLPYDISRVKLSDQNSATDDYINANYMPGYNSKKAFIAAQGPLPSTIEDFWRMI
WEKNIYSIVMLTKCVEQARTKCEQYWPDKQSKSYGDITVTMVSEVVLPEWTIRDFTVEKS
NTPESHTVRQFHFTSWPDHGVPETTDLLINFRHLVHEYSSQNPIDSPTLVHCSAGVGRTG
TFIAIDRLIQQIEMENTVDVYGVVYDLRMHRPLMVQTEDQYVFLNQCVMDIIKSQKDKKT
DLIYQNMTAMAIYENFTPGPGFGKANGYHA
NT seq 3513 nt   +upstreamnt  +downstreamnt
atgtcactatccaacagagcaataagtgatcggaacaatgtaacacagcccgtccctgtt
cttgatatcaaagcagaatatgttggtatgacttacattagcttaacatgggaagtaaat
gacactgcttcgaactcctacacctacaggatagaggttgtaaatggtacttctattagg
aacctgacatccactgtcaccacaactaatattaccgacttaatgcctgggacgttgtat
aatttcacagtaattgcagtagtgaatgatgatgagacagaaggagaaggactgtcaata
ggcctgtatacaaagcccagcccagtccaggatctcaaggcggagtatgttggtgctgag
aaagtcagcttaacatgggcagtgaacaccactgcttccagctcctacacgtacaggata
gaggttgtaagtggtacctctgttaggaacctgacgtccactgtcaccacaactaaaatt
actgagttattccctgggacgatgtacagtttcacagtatttgcagtagcggctgatggt
cagacagaaggagaagcgatgtccatcagcctgtatacaaagcccagcccagtccaggat
ctcaaggcggagtatgttggtgctgagaaagtcagcttaacatgggcagtgaacaccact
gcttccagctcctacacgtacaggatagaggttgtaagtggtacctctgttaggaacctg
acgtccactgtcaccacaactaaaattactgagttattccctgggacgatgtacagtttc
acagtatttgcagtagcggctgatggtcagacggaaggagaagcgatgtccatcagcctg
tatacaaagcccagcccagtccaggatctcaaggcggagtatgttggtgctgagaaagtc
agcttaacatgggcagtgaacaccactgcttccagctcctacacgtacaggatagaggtt
gtaagtggtacctttgataggaacctgacgtccactgtcaccacaactaaaattactgag
ttattccctgggacgatgtacaatttcacagtatttgcagtagcggctgatggtcagacg
gaaggagaagcgatgtccataagcctgtacacaaagcccagcccagtccaggatctcaag
gcggagtatgttggtgctgagaaagtcagcttaacatgggcagtgaacaccactgcttcc
agctcctacacgtacaggatagaggttgtaagtggtacctnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnggcagatgtacaat
ttcccagtatttccagtagcggctggtggtcagacagaaggagaagcgatgtccatcagc
ctgtatacaaagcccagcccagtccaggatctcaaggcggagtatgttggtgctgagaaa
gtcagcttaacatgggcagtgaacaccactgcttccagctcctacacgtacaggatagag
gttgtaagtggtacctctgttaggagcctgtcatccaatgtcactgaagttgaaattact
gagttattccctgggacgatgtacagtttcacagtatttgcagtagcggctgatggtcag
acggaaggagaagcgatgtccatcagcctgtatacaattcctgcagtagtgaattcattt
cattgtgaaccagtggccaagcagtcttccctgatgctgaaatgggaatgtccttctggt
aacaattccggcttcaaaattaaaatctttaatgatacatgggaaaaagaagaatgggct
ccatcctgtatgagagaaggctcagaggaaaccttcagaacattgtctttggattatttc
aggacctatgttgttactattgcaactctttcaaatagttctgaaagccgtccagtgcag
caaatgtgtaatacaagcattactgacccacctgctccaagcaaagctcctttagtcaag
gcagtcagtcacagctcattatctgttgaattctctgattttgagtcagtgaatggaccg
ttgaaagcctatgcagtgatgatcacaacagaagaacaaggttgtgggtctttgaagtct
aaattgaacaacacatacaaagatttcaagaagaggacgacagtcacctatgtaacatac
gtcatagatatagagcaggcaaaatcaccttctttccgttctcagaatggtacaaacatc
attcatgtcggcaagggaaacacaatgtatgcctacgaaaacggaccattgattcctctt
cattcatacagggcaagcattgcaggtttcactaacataacctttactatggccaacatc
attgtgggggaagatagttacgtatcattttcaccctgttctgaggcagttttgctaccc
caggatccaggtgttattgctggagctgttattggatgccttttagctatattggctgta
gtttctatagggggtttcatattctggagaaggagaaggaaagataaaagaaatactgaa
gtgtccttttctcccattaaaatcaagaaatcaaaaatcattaaagtggagaacttcgag
tcctactttaagaagcagcaagctgactccaactgtggttttgctgaagagtatgaggaa
ctcaagtctgctggtgttcatcagcccaaatttgctgctgaacttgccgagaacagggga
aaaaacagatacaacaatgtcctaccatatgatatttctcgtgtgaaactttcagatcaa
aactctgcaactgacgattatattaatgcaaactatatgcctggctataactcaaagaag
gcctttattgccgcacagggccctttacccagtactatagaagacttctggcgcatgatt
tgggaaaagaatatttactctattgtgatgttgacaaaatgtgttgaacaagcccggacc
aaatgtgagcaatactggccagacaaacaatccaagagctacggtgacattactgtgaca
atggtctcggaggttgtccttccagaatggacaataagggacttcactgtagaaaagtct
aacacgccagagagccacacggtgcgccagttccatttcacctcctggccagatcatgga
gtgccggagacaacagaccttctcatcaacttcagacaccttgttcatgagtacagcagt
caaaatccaatcgactctcctactctggtgcactgcagtgctggtgttgggaggacagga
acattcattgccattgaccgcctgattcagcagattgaaatggagaacactgtggatgtg
tatggagtggtgtatgatcttcgcatgcaccgacctttaatggtgcaaactgaggaccag
tacgtcttcctaaaccagtgtgttatggatattattaaatcccagaaagacaagaaaaca
gatcttatttaccaaaacatgacagcaatggcaatctatgagaatttcacacctgggcca
ggcttcgggaaggcaaatggctaccacgcatag

DBGET integrated database retrieval system