KEGG   Falco cherrug (Saker falcon): 102058624Help
Entry
102058624         CDS       T02911                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 6-like
  KO
K05624  transglutaminase 6 [EC:2.3.2.13]
Organism
fch  Falco cherrug (Saker falcon)
Brite
KEGG Orthology (KO) [BR:fch00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102058624
Enzymes [BR:fch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102058624
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core
Motif
Other DBs
NCBI-GeneID: 102058624
NCBI-ProteinID: XP_005445001
LinkDB All DBs
Position
Un
AA seq 708 aa AA seqDB search
MPALIKVIWKNLHQDLTPTHISWQPSLNAGTHHTDRYANTELTVRRGQAFTITLYFNRPQ
QAGESLAFVTEIGPAPSESHRTKAVFPLSQRGASGWSAVQGPSESGYTNFTISSPANAVI
GRYNLILQVTSGNKIFSRFLGQFVLLFNPWCPGDDVYMANENEKQEYVLNENGIIFVGNA
KYIEARGWYYGQFQDHILNICLTMLDLSLYYRQDPAIDVSRRGDPKYVGRVISSMINGND
NDNGVLLGKWQGSFNSHENPSRWDGSMVILQKWRQDNYKPVQYGQCWVFAGVMCTVLRCL
GIPTRLVSNFNSAHDVDRNLSIDKYYDSSGKSLNIGKDSTWDYHVWNESWFVRPDLGTSY
NGWQVLDATPQEQSRGLFQCGPASVIAIKEGDVDLDYDTLFVYTEVNADCNRWIVYKDGS
KKRVYCDTEIIGRFISTKAVDSNSRVDITYNYKYPEGSSEERRVYRKALTKIFGSNITEG
HTESPDERSSETIRNPGISGKLKLAEPPVFGKDINLILILNNLSFDRKTVKVDVSASTIL
YTRRTVTEILKATTSVDLGSKQGKHIRLKIPYSYYGKYLTTDKRIQVTALCGVMNMHGAK
LLVEKTITLEDTNIIIKIPRRVVVNKAVTLEISYANPLPEPVNRCVMLVTLMNQQVKIHL
AQLAPRERSKIYFEFTPRRTGPLQLQVDFSCDKFSHVKGFVTIAVAPA
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgccggcacttataaaagtgatttggaagaatcttcaccaagatctgacaccaacacat
atcagctggcagccatcactaaatgcaggcacacaccatactgacagatatgccaacact
gagttgactgtgaggcgaggacaagccttcactattaccctgtacttcaacagaccacag
caggctggggagagcctagcatttgtcactgaaataggaccagccccctcagaatctcat
cgtacaaaggctgtatttcccctctctcagaggggagcaagtggctggagtgctgtccaa
ggacccagtgagtccggttatacgaactttacaatatccagcccagccaatgctgtcatt
ggacgatacaatctaatcctccaggtaacctcagggaacaagatcttctccagattcctg
gggcagtttgtgttactcttcaacccttggtgcccaggtgatgatgtctacatggctaat
gaaaatgagaaacaagaatatgttctaaatgaaaatggaataatctttgtgggcaatgca
aagtacattgaagcaagaggatggtactatggacagtttcaagatcacattctaaacatc
tgtctcaccatgcttgatctgagcctgtactatcgtcaggacccagccattgatgtatcc
cgaagaggagatcctaaatatgtgggccgagtaatcagttctatgatcaacggaaatgat
aacgataatggtgttctgctaggaaagtggcaaggaagtttcaattcacatgagaatcca
tccagatgggatggcagcatggtaatcctccagaaatggcgtcaggacaactacaaacct
gttcagtatggccagtgctgggtttttgcaggtgtgatgtgtacagttctgaggtgcttg
gggattccaactcgtttggtttcaaattttaactctgcccacgatgtggatagaaatctg
agtatcgataagtactatgacagctctggaaagagtcttaatatcggcaaggattccaca
tgggattatcatgtctggaatgaaagctggttcgttcgcccagacctgggaacatcatac
aatggatggcaggttttggatgcaactccacaagaacaaagcagaggattatttcagtgt
ggccctgcatctgtcatagccatcaaagaaggtgatgtagacttggactatgacacctta
tttgtatatacagaggtgaatgctgattgcaacagatggattgtatacaaggatggaagt
aagaaaagagtttattgtgatactgaaataatcggcaggtttatcagcaccaaagctgtg
gacagcaattcccgtgtggatatcacctataattacaaatatccagaaggttcttctgag
gaaagacgagtttatagaaaggccttgaccaagatatttggatcaaacatcacagaaggc
cacacagaatctccagatgaaagatcttcagagacaattagaaaccctgggatctctggg
aaactcaagctagctgaacctccagtgtttggcaaagacattaacctgatcttaattctc
aataacctatcttttgatcgcaagaccgtgaaggtagatgtgagtgcgtccaccatcctg
tacacaaggagaacagtgacagagatcctgaaggcaaccacttctgtggatcttggttct
aaacaagggaaacacatccggttaaagatcccttattcttattatggaaaatatctgact
actgacaaaaggatccaagtcactgctttgtgtggagtcatgaacatgcatggggcaaag
ttgctggtggagaagactatcactttagaagacacaaacattatcattaagattcctcgg
cgggttgtagtgaacaaagctgttactctagagatctcatatgccaatcccctcccggaa
cctgtgaaccgctgtgtaatgctagtgactttgatgaatcagcaagtcaagatacatctg
gcacaactggcaccgagggagagatcaaaaatttattttgaattcactcctcgcaggact
gggcccttacaactgcaagtagacttctcttgtgacaaattttcacatgttaagggattt
gtaaccattgcagtagcacctgcataa

DBGET integrated database retrieval system