KEGG   Falco cherrug (Saker falcon): 102058755Help
Entry
102058755         CDS       T02911                                 

Gene name
LCT
Definition
(RefSeq) lactase
  KO
K01229  lactase-phlorizin hydrolase [EC:3.2.1.108 3.2.1.62]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch00052  Galactose metabolism
fch01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fch00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    102058755 (LCT)
Enzymes [BR:fch01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.62  glycosylceramidase
     102058755 (LCT)
    3.2.1.108  lactase
     102058755 (LCT)
Chaperones and folding catalysts [BR:fch03110]
 Intramolecular chaperones
  Others
   102058755 (LCT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 102058755
NCBI-ProteinID: XP_014141002
LinkDB All DBs
Position
Un
AA seq 1926 aa AA seqDB search
MEPVCKTVIFFLLVSPSLGIEGEFAQNFITIAGPLPSELVTRLYLQDQVLSEEDQGPAVA
EAHDYLCQQDLVASELPQYFSHLREIGVTHYKIFLPWARVLPEGNARKPAEAQVRCYQEL
LKTLIAAGLRPVAVLHHQRVPGTVAVQAVGGKANAVADLFVEYAEFSFRVFGDLVNVWLS
FSDLPEVLKSLPYDDPQDQAQALAAAHERAYTVYHEKYAPVGGKLSIALGMDHVLDSTLS
ELLSNSIQNSVDFLSLSLQYYCRNETDFYRKLNEFQNVWKDVEILVFSLKFLDCGSTEDN
PFIPVAAIVTAINKEETRTIGYDVNEFLDFSSSQVLSKTNTLQENPDAILAPRSSYQTVW
EMFAQQSEWERDSLLQDVFPGGFLWGISTGAFNIEGAWAEDGKGESIWDHFGHAGHVYMN
QTADMACDSYYKTSYDVYLLRGLHPQLYKFSVSWPRIFPAGTTETVNSKGVDYYNQLINR
LLESNIEPMVTLFHWDLPQALQVLGGWQNDSIIDAFVNYADFCFSTFGDRVKLWITFHEP
WVISYAGYGTGEHPPGIVDPGVASYKVAHTILKAHAKVWHLYNDKYRSQQLGKVGLVLNS
DWAEPKTPTNPEDVRASERYLQFMLGWFAHPVFVNGDYPDILKARIQEVNQQCSTTVAQL
PLFTEQEKSWVKGTADFFGLSHYTSYLVSAMTNGTCTPGYESIGNFSLHVDPSWPQTASS
WIHVVPWGLRRLLKFVSQEYTGTKIPIYIAGNGMPTEDGGDLINDTVRVDYFHRYINEAL
KAVKLDTVDVRSYVARSLVDGFEGPAGYSLKFGLHHVDFGDGNRPRTPRASAYFYSSVIE
KNGFPPEVLDRFSTPVVFDLPVPSKLPSLPASEVPSKAKVVWQKFSSQTDFERDMYFYAT
FPEDFTWGVSSSAYQVEGGWNADGKGPSIWDNFTHVPGNIKNNDNGDVACDSYNKVEEDI
YLLRALGVKNYGFSLSWSRIFPSGRNNSINSHGVDYYNRLIDGLVANNITPIVTLYHWDL
PQALQDIGGWESSVLIDLFDSFADFCFQTFGDRVKFWITFNEPQVIAWAGYGTGTFPPNV
NDPGSAPYRVAHILLKAHARVYHTYDDKYRASQGGVIALCPNIDWVEPKTPSDPRHVEAA
DRYLQFLVGWFTHPIFKNGDYPEVMKWKVGNRSELQDLPSSRLPVFTAEEREYIRGTADV
FCFNTYTSKIVTHATTRLKPFSYEYDQEVSAKTDSSWPPSAITDHRAVAWGMRRLLNWIK
EEYGNPPIYIIKNGVGIKTKSDVDDNTRIFYYKTYIDEALKAYKLDGVNLKGYSAWSFMD
SFEWLNGYEPRFGLHRVDFDNPNRPRTPKRSAVYYAEIIRNNGIPLPKEDEFLYGEFPEN
FRWSVATAAYQIEGGWRADGKGLSIWDRYAHTPLKIGNDDTGDVACDSYHKIEEDVEMLK
SLKVSHYRFSISWSRVLPDGTTRYINEMGLNYYERLIDALLAANIMPQVTLYHWDLPQAL
QNVGGWENDTIVQRFKEYAELLFQRLGDKVKFWITLNEPYNTAYLGYGVGTAAPGVSIRP
GRAPYVVGHNLIKAHAEAWHLYNETYRAKQGGLISITINSDWAEPRNSHKQEDVDAVRQF
LQFFLGWFAHPIFKNGDYNEVMKKRIRERSLAQGLNQSRLPEFTESEKQRIKGTYDYFGL
NHYTTILTYKINYPAGVQSYDSDRGVATVTDRSWLGSGSVWLKVTPFGFRKILRWIKEEY
NNPPIYVTENGISERGAFRFNDTWRTHYLRSYINEALKAVVLDGVDLRGYTVWTLMDNFE
WAVGFDEKFGFYHVNFTDPNLLRRPKASARFYSQIVNCNGFPDPATGPHPCLEVEPEVAP
TDITPGPAASVRFLGLDLTSQNAEIALYVLFALSGVGALGLALFAYLYAKSSRQSPKQPH
MKLSKL
NT seq 5781 nt NT seq  +upstreamnt  +downstreamnt
atggagccagtttgtaagacagtcatcttttttctgttagtttctcccagtcttgggata
gagggggaatttgctcagaattttatcaccattgctggacctctacccagcgagctagtg
actagattgtatctgcaggaccaagtcctctctgaggaagatcagggccctgccgtggct
gaagcccatgattacctgtgccaacaagatcttgtggcttctgaactgccccagtacttc
tcccaccttcgtgagattggagtgacacattacaagatcttcctgccgtgggcacgcgtt
cttccagaagggaatgccaggaagccggctgaagctcaagtgcggtgctaccaggagctg
ctcaagaccctgattgctgcaggcctcaggccagtggcagttctgcatcaccagcgtgtc
cctggcaccgtggctgtgcaggctgtgggtgggaaagccaacgctgttgctgaccttttt
gtggaatacgcagagttcagcttccgtgtttttggagacctggtcaatgtgtggctcagc
ttcagtgacctaccggaggtccttaaaagcctgccttatgatgacccccaggaccaagcc
caggccctggctgccgctcatgaaagagcttacactgtctaccatgagaaatacgcacca
gtgggtggaaagctgtccattgctttaggaatggatcatgtcttggatagcactttatca
gaattgctttcaaattcaattcagaattcggtagattttctgtctctcagccttcagtac
tattgcagaaatgaaacggatttctacaggaagttgaatgaattccagaatgtctggaag
gacgtagagatcttggtttttagtctgaagttccttgattgtggttccacggaagacaat
cccttcataccagtagctgccattgtcacagctattaataaagaagagacacgtacaatt
gggtatgatgttaacgagttcttggacttctcatcatctcaagttttaagcaaaacaaat
actctacaagagaacccagatgccattcttgcccctcgctcgtcctatcagacagtttgg
gaaatgtttgctcaacagtctgaatgggagagagattctcttctgcaagatgttttccca
ggtggcttcctctggggcatatccacaggtgccttcaacatcgaaggagcttgggcagag
gatgggaaaggagagagcatctgggaccactttggacacgcaggccatgtctacatgaac
caaacagcagacatggcatgtgacagctactataaaaccagctatgacgtttacctgctt
aggggtcttcatccccaattgtacaaattttctgtatcctggcctagaattttccctgct
ggcaccaccgagactgtcaactccaagggtgttgattattacaaccaattaattaatcgg
ttgctagagtctaacattgagcccatggtgactctgttccactgggacctcccacaagct
cttcaggttcttggtggctggcagaatgacagtattatagatgcttttgtaaactatgcc
gacttctgcttttccacttttggggatcgagtcaagctctggattactttccatgagcct
tgggttatcagctacgctggctatggcaccggagagcatcctccaggaatcgttgaccca
ggagtagcatcttacaaggtggctcacacaattctcaaggctcatgccaaagtctggcac
ctgtataatgacaaataccgttctcagcaactgggaaaggtggggctggttctgaactcg
gattgggctgaacccaagactccaaccaaccctgaggacgtgagggcatctgagaggtac
ctgcagttcatgcttggctggtttgctcaccctgtatttgttaatggggattacccagat
atcctgaaggctcggatccaggaagtaaaccagcagtgctccacaacagttgcacagctg
cctctgtttacagagcaggagaagtcctgggtgaaagggactgcagatttttttggtctt
tcccattacacttcctacctggtcagtgctatgactaatgggacctgcacaccaggctac
gagagcatcgggaacttctccttgcatgtagatccttcttggccacagactgcctcttct
tggatccatgtggtcccttggggattaagaaggctgctgaagtttgtgtcccaggaatat
acagggacaaagatcccaatttacatagcaggaaatggtatgccaacggaagatggaggg
gatcttattaatgacactgtgcgagtggattatttccaccggtacatcaatgaagctcta
aaagcggtgaaactagacacagttgatgttcggtcatacgtggctcgatccctggttgat
ggctttgaaggcccggcagggtacagcctaaaatttgggctgcatcatgtggattttgga
gatggcaatagaccaaggactcccagggcatctgcttatttctattccagcgttattgaa
aaaaatggtttcccacctgaagtcttggacagattttctaccccagtggtgtttgaccta
cctgtgccatcaaagctgcccagtttaccagcatcagaagttccctccaaggcaaaagtc
gtctggcagaagttttcatcccaaacagattttgaaagggacatgtacttttatgcgaca
ttcccagaggactttacatggggtgtgtcgtcttctgcctaccaggtagagggaggttgg
aatgctgatggcaaaggacccagcatttgggataacttcacccatgtcccagggaatata
aagaataatgataatggagatgtagcttgtgatagctacaacaaggtggaggaggatatt
tacctgctgagagccttaggggtaaagaactatggtttctctctgtcctggtctcgaatt
ttccccagtggaaggaacaactcaataaacagccatggagttgactactataaccgcctc
attgatggactggttgcaaacaacatcactcctatcgtcactctctaccactgggacctg
ccgcaagctctccaggacattggtggctgggagagcagcgtgctgatcgacctgtttgat
agttttgcggatttctgtttccagacctttggtgacagggtgaagttctggattacgttc
aatgaaccccaagtcattgcctgggcaggctatggcactgggacatttccacccaacgtc
aatgaccctggcagtgctccctacagggttgcccacatcttactgaaagctcatgccagg
gtctaccacacgtacgatgacaagtacagagcgagtcaaggaggggtcattgccctgtgt
cccaacattgactgggttgagccaaagacaccaagcgaccccaggcacgtagaagctgca
gacaggtacctgcagtttttggtggggtggtttacacacccgattttcaaaaacggggac
taccctgaggtcatgaagtggaaggttgggaacaggagtgagctccaggacctgccatcg
tctcgcctaccagttttcacagcggaggagcgtgaatacatcaggggcacggcagatgtt
ttctgcttcaacacctacacctccaaaattgtaacccatgcaacgacccggttgaagccc
ttctcttacgagtatgaccaggaagtttcagcaaagactgacagctcctggcctccctca
gctattactgaccatcgggctgtggcctggggcatgaggaggctactgaactggatcaaa
gaagaatatggaaatcccccaatatacatcattaagaacggggtggggataaagaccaaa
tcggatgttgatgacaataccaggattttttactacaaaacatacattgatgaagcttta
aaagcttacaaattggatggtgttaatctgaaaggatacagtgcttggtcttttatggat
agctttgaatggttgaatggttatgagccaagatttggattgcaccgggttgattttgac
aatcccaacaggcccagaaccccaaagcgctctgctgtgtactacgcagaaatcatccgc
aataatggtatcccattgccaaaagaagatgaatttttatatggagagtttccagagaac
tttcggtggagtgtagcgactgcagcatatcagattgagggaggatggagagccgatggg
aaaggacttagcatttgggaccgatatgctcacacccccttgaaaatcggcaatgatgac
actggagatgtagcttgtgacagctaccacaagattgaggaggatgtggaaatgctgaaa
agcctcaaggtgtctcactatcgcttttcaatctcctggtcccgtgttctcccagatgga
accaccagatacatcaatgaaatgggactgaactactatgaaaggcttattgatgctctt
ctggcagctaacattatgcctcaggtaactctctatcattgggacctcccacaggcactg
cagaatgtcggtgggtgggagaatgatactatagttcagaggtttaaggaatatgctgag
ctccttttccagaggctgggagataaagtgaaattttggataaccctcaatgaaccctac
aacactgcatatttgggctatggcgttggcacagccgctccaggcgtctccattcggcca
gggcgagccccctacgtggtggggcacaacttaataaaggcccatgcggaagcctggcac
ctctacaatgagacctaccgggcaaaacaaggaggattaatctcgatcaccatcaactct
gactgggcagaaccaaggaactcccacaaacaggaggatgttgatgctgtcagacaattc
ttgcagttttttctaggttggtttgctcatcccattttcaaaaatggtgactataatgaa
gtgatgaaaaagaggattcgggaacgcagtctggctcagggtctgaaccagtcccgactt
ccagaatttactgaaagtgaaaagcaaagaattaaaggcacatatgactactttggccta
aatcattatactacaattttaacatacaaaataaactatcctgctggtgttcagtcatat
gactctgacaggggtgtagctactgtaactgaccgcagctggctgggttctggttctgtc
tggctaaaggtgacaccctttggtttccgaaaaatcctgagatggataaaagaagagtac
aacaaccctcccatttacgtcactgaaaatgggatctcagaaaggggagccttccgcttc
aatgacacttggcgaacacattacctccggagctacattaacgaagcactgaaagctgtg
gtgctcgacggtgtcgacttaagaggctacactgtatggacgctgatggacaactttgag
tgggcagtgggctttgatgagaagtttgggttctatcatgtgaatttcacagaccccaac
ctgctgcgccgccccaaggcttctgccaggttttactcgcagatcgtaaactgcaacggg
tttccagacccagcaacaggcccgcatccctgtctggaagtggagcctgaagtggcaccc
acagacatcacaccaggaccagctgccagcgtgcgctttttgggattagatttaacatca
caaaatgcagaaatagcactgtacgtgctttttgctctgtcaggagtaggagcattgggc
ttagctctttttgcatacctgtatgcaaaatcatccagacaatcccctaaacaaccacac
atgaaacttagtaaactgtaa

DBGET integrated database retrieval system