KEGG   Falco cherrug (Saker falcon): 102058790
Entry
102058790         CDS       T02911                                 

Gene name
AFDN
Definition
(RefSeq) afadin
  KO
K05702  afadin
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04520  Adherens junction
fch04530  Tight junction
Brite
KEGG Orthology (KO) [BR:fch00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102058790 (AFDN)
   04530 Tight junction
    102058790 (AFDN)
SSDB
Motif
Pfam: RA DIL PDZ PDZ_6 FHA PDZ_2 Yop-YscD_cpl DUF4477
Other DBs
NCBI-GeneID: 102058790
NCBI-ProteinID: XP_027666726
LinkDB
Position
Unknown
AA seq 1799 aa
MRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGEE
RRLDVDEKPLVVQLNWNKDDREGRFVLKNENDTLPPKKAQSNGPEKQEKEGVIQNFKRTL
SKKEKKEKKRREKEALRQASDKDDRLLHGDDIENSRLAAEVYKDMPETSFTRTISNPEVV
MKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVIEA
LEKYGLEKENPKDYCIARVMLPPGAQHSDDKGAKETILDDDECPLQIFREWPSDKGILVF
QLKRRPPDYVPKKSKKIIDGKPLKGKERVDGSGYGSCLPPEKLPYLVELSPGRRNHFAYY
NYHAYEDGSDSRDKPKLYRLQLSVTEVGTEKFDDNSIQLFGPGIQPHHCDLTNMDGVVTV
TPRSIDAETYVEGQRISETTMLQSGMKVQFGSSHVFKFVDPTQDHIIPKRPIDASLMVKG
PRHKTGAVQETTFDLEGDVHSGTALPTSKSTSRLDGDRTSSASSTAERGMVKPMIRIEQQ
QDYRRQESRPQDTHGPELILPASIEFRESSEDAFLSAIINYTNSSTVHFKLSPTYVLYMT
CRYVLSSQYRPDITPAERTHKVIAIVNKMVNMMEGVIQEVDQVDQKQKNIAGALAFWMAN
ASELLNFIKQDRDLSRITVDAQDVLAHLVQMAFKYLIICINSNLHRFYNFFVVDVLSADP
EENNPQRPKIDDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTAPDSG
LCSHYWGAIVRQQLGHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYSHADVPNINST
CFKLNSLQLQALLQNYHCAPDEPLIPTELIENVVTVAENTADELARSDGREVQLEEDPDL
QLPFLLPEDGYSCDVVRNVPSGLQEFLDPLCQRGFCRLTPHSRSPGTWTIYFEGADYESH
LSHENAELAQPLRKEPEIITVTLKKQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVD
GRLAAGDQLLSVDGRSLVGLSQERAAELMTRTGSVVTLEVAKQGAIYHGLATLLNQPSPM
MQRVSDRRGSGKPRPKSEGFELYNNATQNGSPESPQLPWTEYSEPKKLPGDDRLMKNRAD
HRSSPNVANQPPSPGGKNAYASGTTTKITSVSTGNLCTEEQTLPPRPEAYPIPTQTYTRE
YFTFPASKSQDRMGPAQSQWPNYEEKPQVQAESNHSINTTMQRVARSQEELRDKVFQPER
NRLEVVIRKDVEYLDRKSDSDQWMNSSVDSSTSSQEHLNHSSKPVSPGSCLTKSGPGRWK
TPATSQPTPVAISQPIRTDLPPPPPPPPVHYAAEFDELQMDLPLPPPPPPNQIGAQASSQ
VAAAERKKREEHQRWYEKEKARLEEERERKRREQERKLGQMRSQPLIPAQPVVPPVSLQQ
VKSEKPSTLQRSQETVIRELQPQQQPRTIERRDLQYITISKEELSSSDSLSPDPWKRDAK
EKLEKQQQMHIVDMLSKEIQELQNKPDRTAEENDRLRKLMLEWQFQKRLQESKQKDEDDD
EEEDDDVDTMLIMQRLEAERRARDEERRRQQQLEEMRKREAEDRARQEEERRQQEEERTR
REAEEKRRQEEEYYSRLEAERRRQHDEAERRLLEPDEPGLYRPPLPREYELPSPTPSSNA
PPPPPQRNTSYLKTQVLSPDTIYTAKFVAYNDDDEEEEDSNLAGINSYTGSTGAAVGAHE
VYRDPRDKRSKSQDTDLPGAPENLTFRERQRLFSQGQDVSNKVKASRKLMELENELNTK
NT seq 5400 nt   +upstreamnt  +downstreamnt
atgagattctactttcaagataaagcagctggaaatttcgcaacaaaatgtatccgtgtc
tctagtactgccacaactcaagatgtgatagaaactcttgcagagaagtttcgaccagac
atgcgaatgttgtcatcccctaaatactcgctttatgaggtgcatgtcagtggagaagaa
agaagattagatgtagatgagaagcctcttgttgtacaattaaactggaacaaagatgat
cgagagggaagatttgttctcaagaatgagaatgatacacttcctccaaagaaggctcag
agtaatggccctgaaaaacaagaaaaagagggggtaattcagaatttcaaaagaactctt
tcaaaaaaagaaaaaaaagaaaaaaagaggcgtgaaaaagaggcattgcgacaagcgtca
gataaagatgatagacttcttcatggggatgatattgagaattctcgccttgcagctgag
gtttacaaagatatgcctgagaccagcttcactcgcacaatatccaatcccgaggtggtt
atgaaacggcggcggcagcaaaaactggagaagagaatgcaggaatttcgcagttctgat
ggcaggccagactcgggtgggacactgagaatttatgcagacagtttaaaaccaaatata
ccgtacaagacaatcctgctgtccactacagatactgcagactttgcagttattgaagca
ctggaaaaatatggtctggagaaggaaaatcccaaggattattgtattgcacgtgtcatg
ttgcctcctggtgctcagcactctgatgataaaggtgctaaagaaactatccttgatgat
gatgagtgtccactgcagatatttagggagtggcctagtgataaaggaatactagtcttt
caattgaagaggcggcctcctgattatgtcccaaagaaatccaagaaaatcattgatgga
aagccattaaaggggaaggaaagagttgacgggtctggttacggctcttgccttcctcca
gagaaactaccatacctggtagaattaagcccagggagaaggaatcactttgcctactac
aactatcacgcttatgaagatggttctgactccagagataagccaaagctttatcgtcta
cagttaagtgtcactgaagttggaaccgaaaaatttgatgacaattccattcagttattt
ggtccaggaattcagcctcatcattgtgacctcactaatatggatggagttgttactgta
accccaagaagcattgatgccgaaacctacgtggaaggtcagcgtatttcagaaaccact
atgctgcaaagcggaatgaaggttcagtttgggtcatctcatgtatttaagtttgtggat
cccactcaggatcatattattcctaaaagacctattgatgcaagtcttatggtcaaaggt
ccaagacacaaaactggagctgttcaggaaaccacatttgatctggagggagatgttcac
agtggaacagcattaccaacaagcaagagcaccagcaggcttgatggtgacaggacatca
tcagcatccagcacagctgaacgaggaatggtgaagccgatgattagaatagaacagcag
caagattaccgcagacaggaaagcagacctcaggatacccatggaccagaactgatacta
cctgccagtattgaattcagggaaagctctgaagatgccttcttatctgccattataaat
tacacaaatagctcaacagttcattttaagctgtcacctacgtatgttttgtatatgaca
tgtcggtatgtattgtcaagccagtacagacctgacatcactcctgctgagcgtactcac
aaagtcattgccatagtcaacaagatggtgaacatgatggaaggagtgatacaggaggta
gaccaggttgatcagaaacagaaaaatattgctggagcccttgccttttggatggcaaat
gcatctgagttactgaatttcataaagcaagacagagatcttagccgaattactgtggat
gcacaagatgttttggcacacttggttcaaatggcattcaagtatttgataatttgcata
aatagcaatttgcataggttttacaatttttttgttgttgatgttctctctgccgatcca
gaggaaaataatcctcagaggcctaaaatagatgatgtgctgcatacattgactggagct
atgtccctgctgcgacgatgtagagtgaatgctgctctgactatacagctcttctcccag
ctgtttcattttatcaacatgtggctcttcaacagattagtgacggccccagattcaggg
ttatgttcacattactggggagctattgttcgtcaacagttgggccacattgaagcctgg
gcagaaaaacagggtttagaattggctgctgattgccacctgagcagaatagtgcaggca
accacattgcttaccatggacaaatactcacatgcagatgttccaaatattaacagtact
tgctttaagctgaattctctgcagctacaagctttgctgcagaattatcactgtgctcca
gatgaaccactcatcccaacagaattgatagagaatgtagtaactgttgcagaaaatacc
gctgatgaacttgctcgcagtgatggccgagaagtccaactggaagaggatcctgacttg
cagctaccttttcttttaccagaagatggctattcctgtgatgttgtcagaaatgttcca
agtggtttacaagaatttttagatccactctgccagagaggtttttgtagattaacccct
cattcacggtcaccaggcacgtggacaatatactttgaaggtgcagactatgaaagtcac
ctgtcacatgagaatgctgagctagctcagcctttgaggaaagaacctgagattatcact
gtaacactgaaaaaacaaaatggaatgggcctgagcattgttgctgccaagggtgctggt
caagacaaacttggaatatatgtcaagtctgttgtgaaaggaggtgctgcagatgtggat
ggtcgtctggctgcaggggatcagttgctcagtgtggatggtcgaagtttggtgggcctg
tcccaggaaagggcagcagaacttatgactaggacaggttccgtagtaacactagaagta
gcaaaacaaggagcaatttaccatggtctggcaactctgcttaatcagccatccccaatg
atgcaaagagtttctgaccgccgtggctcaggtaaaccccgaccaaagagtgaaggcttt
gagctgtataataacgccactcagaatgggtcacctgagagcccccagctgccatggact
gagtacagtgaaccaaagaagctgccaggggatgatagattaatgaagaacagagctgat
catcgctccagtcccaatgtagcaaatcagcctccaagccctgggggaaagaatgcttat
gcatctggaactaccaccaaaataacctcagtctctactggaaatctttgtacagaggaa
cagactctgcccccacgacctgaagcttatcccatcccaacacagacctatactagagaa
tatttcacattcccagcttcaaagtcccaggatcgaatgggtccagctcagagtcagtgg
ccaaattatgaagaaaaaccacaggtccaggcagaaagtaatcattctatcaatactaca
atgcagcgtgtagctcgttcccaggaagaactcagagataaagttttccagccagagagg
aatcgtttggaagttgttatacggaaggatgtagagtacctcgatcggaagtcagacagt
gatcagtggatgaattcatccgtggattctagcacgtctagccaagaacacctgaaccat
tcatccaaaccagtctcgcctggttcctgtttaactaaaagtggacctggccgttggaaa
actccagctaccagccagccgactccagtggccatttcccagcccatcagaacagatctt
ccccctccaccaccaccgcctccagtgcattatgcagctgaatttgatgaactacaaatg
gatttgcctctgcctccccctccccctccaaatcagataggagcacaagcatcctcccag
gtcgctgctgctgagcgtaaaaagagagaagagcatcagaggtggtatgaaaaggaaaag
gcacgtttggaagaggagcgagaaaggaaacgtcgtgagcaggagagaaaactgggccaa
atgcgttctcagccactaattcctgctcagcctgtggttcctcctgtttctcttcaacaa
gtgaaatcagaaaaaccttcaactttgcagaggtctcaagaaactgtcattcgagagttg
cagccccaacagcagcctcggactattgagcggagagatctccagtacattactatcagc
aaggaagaactgtcctctagtgatagcctctctccagatccctggaaacgggatgctaag
gagaagctggagaagcagcagcagatgcacattgtggacatgctgagtaaagagattcag
gaacttcagaacaagcccgatcgtacagcagaagaaaatgaccgcctccgcaaactcatg
cttgagtggcagttccaaaagcgacttcaagagtcaaagcaaaaggatgaagatgatgat
gaagaggaggatgatgatgtggatactatgctcatcatgcagcgactggaggcagaaaga
agagcaagggatgaagaacgcagacggcagcaacaacttgaggaaatgcgcaaacgagaa
gcagaagacagggccaggcaggaagaagagcgccgacagcaagaggaggagcggaccaga
agagaggctgaagaaaagaggcggcaggaagaggagtattacagtcgcttagaggctgaa
aggcgcaggcagcatgatgaagcagaacgaagattactggaacctgacgagcctggtctg
tacagacctccacttccacgggaatatgaactcccatccccaaccccttcatctaacgct
cctcctcccccacctcagcgaaacacctcttacctcaaaacacaggtcctctcccctgac
acgatttatactgccaagtttgttgcatacaatgatgatgatgaggaggaggaggattcc
aatctagcaggaataaattcatacactggatctacaggagcagctgttggagcccatgaa
gtttatcgggatccaagagacaaaagatctaaaagtcaagatacagatttacctggagca
cccgagaacttgacgttcagggaacgtcagcgactcttttcacagggtcaggatgtatcc
aataaagtaaaagcttctaggaaattaatggaactggaaaacgagttgaacacaaaataa

DBGET integrated database retrieval system