KEGG   Falco cherrug (Saker falcon): 102058816
Entry
102058816         CDS       T02911                                 

Gene name
MAP3K7
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 7 isoform X1
  KO
K04427  mitogen-activated protein kinase kinase kinase 7 [EC:2.7.11.25]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04010  MAPK signaling pathway
fch04140  Autophagy - animal
fch04310  Wnt signaling pathway
fch04520  Adherens junction
fch04620  Toll-like receptor signaling pathway
fch04621  NOD-like receptor signaling pathway
fch04622  RIG-I-like receptor signaling pathway
fch05132  Salmonella infection
fch05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102058816 (MAP3K7)
   04310 Wnt signaling pathway
    102058816 (MAP3K7)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102058816 (MAP3K7)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102058816 (MAP3K7)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102058816 (MAP3K7)
   04621 NOD-like receptor signaling pathway
    102058816 (MAP3K7)
   04622 RIG-I-like receptor signaling pathway
    102058816 (MAP3K7)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102058816 (MAP3K7)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102058816 (MAP3K7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fch01001]
    102058816 (MAP3K7)
Enzymes [BR:fch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     102058816 (MAP3K7)
Protein kinases [BR:fch01001]
 Serine/threonine kinases: TKL group
  MLK family
   102058816 (MAP3K7)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase APH
Other DBs
NCBI-GeneID: 102058816
NCBI-ProteinID: XP_027653791
LinkDB
Position
Unknown
AA seq 551 aa
MEYAEGGSLYNVLHGAEPLPHYTAAHAMSWCLQCSQGVAYLHSMKPKALIHRDLKPPNLL
LVAGGTVLKICDFGTACDIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVI
TRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKI
MTHLMRYFPGADEPLQYPCQYSDEGQSNSATSTGSFMDITSTNTSNKSDANVEPGDFQGA
STNDTIKRLESKLAQQMKNTAKQPGDPGRLSLPPSRGSSVESLSDVRVRPQSALVSGEAK
RMSADMSEIEARIASITAYSKPKRGHRKTASFGNILDVPEIIIPAGNGQQRRRSIQDLSV
AGTESSQESRNSSRSSSPSVRMITTSGPTSEKPARNPWTPDDAAALGDSIVFEGNTLVSL
PRLLCGRCFWGMETNGSDNSIPMAYLTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMK
VQTEIALLLQRKQELIAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVI
RNQQQKRPGTS
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggagtatgctgaaggaggttctctatacaatgtgctgcatggtgctgaacctctgcct
cattatactgctgcacatgccatgagttggtgtttacagtgttcccaaggagtggcttat
ctccacagcatgaaaccaaaggctctaattcacagagacctgaaaccaccaaatttgctc
ttggtagctggggggacagttctaaaaatctgtgactttggtacagcctgtgatattcaa
acacacatgaccaacaataagggaagtgctgcttggatggcacctgaagtttttgaaggt
agcaattacagtgaaaaatgtgacgttttcagttggggtattattctctgggaggtaatc
acccgtaggaaaccttttgatgagattggtggtccagctttccgcataatgtgggcagtt
cacaatggtactcggccaccactgatcaaaaacttacctaaaccaattgagagtttaatg
acccgttgttggtccaaggatccctcacagcgaccatccatggaagaaattgttaaaata
atgacacacttgatgcggtactttccaggagctgatgaacctctgcagtatccttgccag
tattcagatgaagggcaaagcaactctgccactagtacaggttcattcatggacatcact
tctacaaacacaagtaacaagagtgatgctaatgtggaaccaggtgacttccaaggagct
tctaccaatgacactattaaacgtttagagtcaaaattggcacagcaaatgaaaaataca
gccaagcagccgggtgatcctggtcgtttgagtttacccccatctcgtgggagcagcgta
gagagcttgtcagatgttcgcgtgcgaccacagtcagccctcgtttcaggagaagccaaa
aggatgagtgctgacatgtctgaaattgaagcaagaatagcttccatcacagcctattcc
aagcctaaacgaggccatcgtaaaactgcttcatttggcaacattctggatgttcctgag
atcatcataccagcaggaaacggacagcagaggcgcagatccattcaagatcttagtgtt
gctggaacagagtccagtcaggagagtagaaacagcagtagatcatctagtcctagtgtg
agaatgatcactacctcgggaccaacctctgaaaagccagctcgtaatccatggacacct
gatgatgcagctgctcttggagatagcatagtctttgagggcaacaccttagtttctcta
ccacgactactctgtggcaggtgcttttggggtatggagaccaatgggtcagataactcc
atcccaatggcatatcttacattagatcatcagttacagcctctagcaccgtgcccaaac
tccaaagaatctatggctgtgtttgaacagcactgcaaaatggcacaagagtatatgaaa
gttcagacagaaattgcattgctgttgcagaggaaacaagaactaatagcagaactggac
caggatgaaaaagaccagcaaaacacatcccgtctggtacaagaacacaaaaagctgtta
gatgaaaacaaaagtctctcaacttactatcagcaatgcaaaaaacaattagaggtcatc
agaaatcagcaacagaaacggccaggcacatcatga

DBGET integrated database retrieval system