KEGG   Falco cherrug (Saker falcon): 102059299Help
Entry
102059299         CDS       T02911                                 

Gene name
PFKP
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type isoform X5
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch00010  Glycolysis / Gluconeogenesis
fch00030  Pentose phosphate pathway
fch00051  Fructose and mannose metabolism
fch00052  Galactose metabolism
fch01100  Metabolic pathways
fch01200  Carbon metabolism
fch01230  Biosynthesis of amino acids
fch03018  RNA degradation
Module
fch_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:fch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102059299 (PFKP)
   00030 Pentose phosphate pathway
    102059299 (PFKP)
   00051 Fructose and mannose metabolism
    102059299 (PFKP)
   00052 Galactose metabolism
    102059299 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    102059299 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fch01009]
    102059299 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:fch03019]
    102059299 (PFKP)
Enzymes [BR:fch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     102059299 (PFKP)
Protein phosphatases and associated proteins [BR:fch01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102059299 (PFKP)
Messenger RNA biogenesis [BR:fch03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     102059299 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 102059299
NCBI-ProteinID: XP_014137945
LinkDB All DBs
Position
Unknown
AA seq 757 aa AA seqDB search
MNAAVRAVVRMGIYVKAKVYFVYEGYQGMVDGGDNIVEVSWESVSSILQVGGTVIGSARC
KSFRTREGRLQAAYNLVQRGITNLCVIGGDGSLTGANLFREEWSGLLEELAQKGKIDEEA
VKKYAYLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMG
RHCGYLALVSALACGADWVFIPEYPPEEGWEDSMCVKLSENRARKKRLNIIIVAEGAIDC
HNKPITSEKVKDLVVQRLGFDTRVTILGHVQRGGTPSAFDRILASRMGVEAVLALLEATP
ATPACVVSLSGNQAVRLPLMECVQMTQEVQKAMDEGRFVEAVRLRGRSFENNLNTYKLLS
HKKPDAELPKTNFNVAVLNVGAPAAGMNAAVRAAVRVGITEGHKMFAVIDGFEGFARGKI
KEISWGDVGGWTGQGGSILGTKRTLPAKYLEKIADQMRTNNINALMVIGGFEAYLGLLEL
SAAREKYDEFCVPMVMVPATVSNNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVF
IIETMGGYCGYLANMGALAAGADAAYIFEEQFDIRELQANVEHLTEKMKTSIQRGLVLRN
ENCNENYTTDFIYQLYSEEGKGVFDCRKNVLGHMQQGGAPSPFDRNFGTKISAKAMQWIS
KKLKETYRKEEGKVFANTDDSVCLLGMRRRNLVFQPVAELKTETDFVHRIPKEQWWLKLR
PLMKILAKYKTSYDVSDSGQLEHVAMHSPKEAETGAI
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgctgtgcgcgcagtagtacgcatgggaatctatgtaaaagccaaagtgtat
tttgtttatgagggttaccagggaatggttgatggaggtgataatattgtagaagtttca
tgggaaagtgtttcaagtatcctacaagtgggaggtacagttattggtagtgcacgctgc
aaatcttttcgtacccgtgagggccgcctgcaggcagcctacaacttggttcaaagagga
atcactaatctttgtgtgattggcggagatggtagcttaaccggtgcaaatctgttccgt
gaagaatggagcggacttctagaagaactggcgcagaaaggaaagattgatgaagaggct
gttaagaagtatgcttaccttaacattgtgggaatggttggatccatagataatgacttc
tgtggcactgatatgaccataggtactgactcagccttgcacagaatcattgaggttgtg
gatgccattatgaccactgctcaaagccatcagaggacatttgttctggaggttatgggg
agacactgtgggtatctagctcttgttagtgccttagcctgtggtgcagattgggtattt
attcctgaatacccaccagaagaaggatgggaagattcaatgtgtgttaagctctcagag
aatcgtgcacgaaagaaaaggctgaatattattattgtagctgaaggagctattgactgc
cacaacaaacctataacgtcagagaaggttaaggatcttgtggttcagcgacttggtttt
gacacccgagtaactatcttgggtcatgtgcaaagaggtggaaccccttcagcttttgac
agaattttggcaagtcgtatgggtgtggaagctgtgcttgcccttttagaagctactcca
gctacccctgcctgtgtcgtgtccctgtctggaaaccaggctgtccgtctgcctttgatg
gagtgtgtgcagatgactcaagaagtccagaaagccatggatgagggaagatttgttgag
gctgtgaggcttcgtggaaggagctttgaaaacaaccttaacacctacaaattgctgtcg
cacaaaaaaccagacgctgagcttccaaagactaattttaatgtggcagttttaaatgtt
ggtgcccctgcagctggaatgaatgctgcagtgagggctgcagtgagagttggcataact
gaaggccataaaatgtttgctgtcattgatggatttgaaggttttgctagagggaagata
aaggaaatcagctggggagatgttggaggctggactggtcaaggaggatcaattcttggt
acaaaacgtactcttcctgcaaaatatttggagaagattgctgaccagatgcgcactaac
aacattaacgcccttatggttattggtggatttgaggcgtaccttggacttctggaattg
tcagctgcccgagagaaatatgacgaattctgtgttccaatggttatggttcctgcaact
gtatccaacaatgtaccgggttcagatttcagcattggtgcagatactgctctgaacact
atcactgatacatgtgatcgcatcaaacaatcagccagtggtaccaaacgtcgtgttttc
atcattgagaccatgggtggttattgtggttatctggctaatatgggggcccttgcagca
ggagctgatgctgcttatatctttgaagaacagtttgatattcgagagctccaggctaac
gtggaacacttgactgaaaaaatgaaaaccagtatccagcgtggtctagtgctgagaaac
gagaactgcaatgagaattacacaactgacttcatttatcagttgtattctgaagaagga
aagggagtgtttgactgtcgaaagaatgtactgggccacatgcaacagggcggtgcacct
tcaccatttgataggaacttcgggacaaagatttctgcaaaagctatgcagtggatctcc
aaaaaactgaaagaaacctaccgaaaagaagaaggaaaagtatttgccaatactgatgac
tctgtctgtttgctgggaatgcgtagacgcaaccttgttttccaaccagtggctgagctc
aagactgaaacagactttgtacacaggatccccaaggaacaatggtggctgaagctgcga
cccctgatgaaaatcctggccaagtacaagactagttacgatgtttcagattcaggccag
ctggagcatgttgctatgcacagcccaaaggaagcagaaactggagccatctaa

DBGET integrated database retrieval system