KEGG   Falco cherrug (Saker falcon): 102059808
Entry
102059808         CDS       T02911                                 

Gene name
PARD3
Definition
(RefSeq) partitioning defective 3 homolog
  KO
K04237  partitioning defective protein 3
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04080  Neuroactive ligand-receptor interaction
fch04144  Endocytosis
fch04520  Adherens junction
fch04530  Tight junction
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102059808 (PARD3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102059808 (PARD3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102059808 (PARD3)
   04530 Tight junction
    102059808 (PARD3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fch01009]
    102059808 (PARD3)
Protein phosphatases and associated proteins [BR:fch01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102059808 (PARD3)
SSDB
Motif
Pfam: Par3_HAL_N_term PDZ PDZ_6 PDZ_2 TPR_11
Other DBs
NCBI-GeneID: 102059808
NCBI-ProteinID: XP_027665515
LinkDB
Position
Unknown
AA seq 1155 aa
MKVTVCFGRTRVVVPCGDGNMKVFSLIQQAVTRYKKAIAKDPNYWIQVHRLEHGDGGILD
LDDILCDVADDKDRLVAVFDEQDPHHGGDGTSASSTGTQSPEIFGSELGSNAASAFQPYQ
ATSEIEVTPSVLRANMPLHVRRSSDPALIGLSTSVSDTNFSSEEPSRKNPTRWSTTAGFL
KQNTPGVPSTHERKKDENYRSLPRDTNSWSNQFQRDNARSSLSASHPMVDKWLERQEQDE
DRTEEDNSRVEPVGHADTVLENATNFSLECTEGLGFSITSRDVPIGGSAPIYVKNILPRG
AAIQDGRLKAGDRLIEVNGVDLTGKTQEEVVSLLRSTKMGGTVGLLIFRQEETFHPRELN
AEQSQSQIPKETKAEEEELVLTPDGTREFLTFEVPLNDSGSAGLGVSVKGNRSKENHADL
GIFVKSIINGGAASKDGRLRVNDQLIAVNGESLLGKTNQDAMETLRRSMSTEGNKRGMIQ
LIVARRISKCNELESPGSPSGPELPIETLLDDRERRISHSLYGGIEGLSESPTKNAALSR
IMGKYQLSPTVNMPQDDTVIIEDDRLSVLPPHLSDQSSSSSHDDVGFGTVDAGGWAKAAI
NESTDCTLSPDVDPVLAFQREGFGRQSMSEKRTKQFSDASQLEFVKTRKSKSMDLVADET
KLSTMDDQKTGSPTRDVGPSLGLKKSSSLESLQTAVAEVTLNGDIPFHRPRPRIIRGRGC
NESFRAAIDKSYDKPVADDDDEGMETLEEDTEESSRSGRESVSTASDQPSHSLERQMNGS
QDKGDRKKAGKEKKKDRDKEKDKIKAKKGMLKGLGDMFRFGKHRKDDKSEKTGKIKVQEA
LTSEEERIRMKQEQERIQAKTREFRERQARERDYAEIQDFNRTFGCDADPMYAGIASYDS
SSNSGTITLNARPQSPREGQTVEALYAQVKKPRNSKSSRLDSNRSTPNNHDRIQRLRQEF
QQAKQDEDVEDRRRTYSFEQPWPSTKTYSQSGRHSVSVEVQMQRQRQEERESFQQAQRQY
SSLPRQSRKNASSVSQDSWEQSYSPGEGFQTAKENPRYSSYQGSRNGYMGGHGFNARVML
ETQELLRQEQRRKEQQLKKKPSSEGPSNYDSYKKIQDPNYTPPKGPFRQDVPPSPSQVAR
LNRLQTPEKGRPFYS
NT seq 3468 nt   +upstreamnt  +downstreamnt
atgaaagtcaccgtgtgcttcgggaggacgcgggtggtcgtgccctgcggggacgggaac
atgaaagttttcagcctgatccagcaagcggtgacccggtacaagaaggcgatcgccaag
gatccaaactactggatacaagtacatagactggaacacggggatggtgggatcttagat
ctcgatgacattctttgtgatgtagccgatgacaaagaccgtcttgtagctgtatttgat
gagcaagatccgcaccatggaggtgatggcaccagcgccagctcaacaggcacgcaaagc
ccggagatttttggcagcgagcttggctccaatgcggcatcggcctttcagccttaccaa
gcaacaagtgaaattgaggtcaccccttcagtccttcgtgcaaatatgcctcttcatgtc
cgacgtagtagtgaccctgcactgattggcctctcaacctctgtaagtgacacaaatttt
tcctcagaagagccttcacggaaaaaccctacaaggtggtccacaacagcaggctttctc
aagcagaacacccccggtgtacccagcactcatgaaagaaagaaagatgaaaactacaga
agcctaccacgagatactaatagctggtctaaccagtttcagagagacaatgctcgttca
tcgttaagtgccagtcatcccatggtggacaagtggctggagaggcaagaacaggatgaa
gatcgaacagaggaggacaatagcagagttgagcctgttggacatgcagacactgttttg
gagaatgctaccaatttttccctggagtgtacagaaggcttgggatttagcattacttca
agagatgtcccaattggtggctctgctccaatttatgtgaaaaacatccttccgagaggt
gcagctattcaagatgggagactaaaagctggagaccgattaattgaggtaaatggagtt
gacttaacaggcaaaactcaagaagaagttgtgtccttgctgcgaagcaccaagatggga
gggaccgttggccttctgatttttcgacaagaagaaacattccatccaagggaactgaat
gcagaacaaagccagtcacaaattccaaaggaaacgaaagcagaagaagaggagcttgtc
ctcacccctgatggcaccagggaattcctgacatttgaagttccactgaatgactcagga
tcagctggacttggcgtgagcgtcaaaggtaaccggtcaaaagaaaaccatgctgattta
ggaatcttcgtcaagtccattattaacggtggagcagcatccaaggatggcaggcttcga
gtgaatgatcaactaatagcagtaaatggagaatcattattgggcaaaacaaatcaagat
gctatggaaaccttaaggaggtccatgtctactgaaggaaacaaacggggaatgattcag
cttattgttgcaaggcgaataagtaaatgcaatgagttggagtcacctgggagcccttcg
gggccagagctgcccatagagactctgctggatgaccgggagcggaggatttcccactcc
ctctatggtgggatcgagggtctcagcgagtcgcccacgaagaacgcagcactgagtagg
ataatgggtaaatatcagctgtctccaacggtgaacatgccccaagatgacactgtcatt
attgaagatgacaggctgtcagtcctccctcctcatctctctgaccagtcgtcatccagt
tcccatgatgatgttggatttggcactgttgatgctggtggatgggctaaagctgcaatt
aatgagtcaacagactgcactcttagtccagatgttgatccagtgcttgccttccagcga
gagggttttggacgccagagcatgtcagaaaagcgtacaaagcaattttcagatgccagt
cagttggagtttgttaaaacacgaaaatccaaaagcatggatctagtagctgacgagact
aagctcagtacaatggatgaccagaaaacaggttccccaaccagagatgtggggccttca
ttaggtctgaagaaatccagctcattagaaagtctgcagacagccgttgctgaggtgact
ctgaatggcgatattcccttccaccgcccgcgcccgcggattatccgaggacgaggctgc
aacgaaagcttcagagctgccatagacaaatcatacgataaacctgtagcagatgatgat
gatgaaggcatggaaactttggaggaagacacagaggaaagctcaagatctggtagagaa
tctgtgtccacagcaagtgaccagccatcccactcattggagagacagatgaatggaagc
caagataaaggggacagaaaaaaggctggaaaggaaaagaagaaagatcgagataaagag
aaggataaaattaaggcaaagaaagggatgctgaaaggcttaggggacatgttcaggttt
ggcaaacatcgcaaagatgacaagagtgaaaaaactggtaaaataaaagtgcaggaagct
cttacttcagaagaggagagaatacgaatgaagcaagaacaggagagaattcaagcgaaa
actcgagaatttcgagagagacaagctcgtgaacgtgactatgcagagatacaggatttt
aaccggacgtttggctgtgatgcggacccaatgtacgctgggatcgcttcctatgactct
tcttcaaacagtggcacgataacgctgaatgcccgaccgcagagcccaagggaagggcag
acagtggaagccttgtacgcccaagtaaagaaaccacggaattcaaagtcttcacgttta
gacagcaacagatcaacccctaacaatcatgaccggatacagcgcctgagacaggagttt
cagcaagcgaagcaggatgaggacgtggaagataggcgacgtacttacagttttgagcag
ccgtggccaagcaccaagacatactcacagagtggccgacactcagtatcagtagaggtt
caaatgcagcggcagcggcaagaagaaagagagagtttccaacaagctcagcggcagtac
agctcattacccaggcaaagcagaaaaaatgccagttctgtatctcaagactcctgggag
cagagctattcccctggagaagggttccagactgcaaaggaaaatcccagatattccagc
taccagggatcgaggaatggctacatggggggacatggcttcaatgccagggtaatgcta
gaaacacaggaactgcttcgtcaagagcagaggcggaaagaacaacaactgaaaaaaaaa
ccttcttctgaagggcctagcaactatgactcatataagaaaattcaagaccctaattat
acccctcctaaaggtcctttcaggcaagacgtaccaccttcaccatctcaggtagcgagg
ctgaacagattgcaaacaccagaaaagggaaggccgttttattcttga

DBGET integrated database retrieval system