KEGG   Falco cherrug (Saker falcon): 102059954
Entry
102059954         CDS       T02911                                 

Gene name
SNAI2
Definition
(RefSeq) zinc finger protein SNAI2
  KO
K05706  snail 2
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:fch00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102059954 (SNAI2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fch03000]
    102059954 (SNAI2)
Transcription factors [BR:fch03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 Snail
    102059954 (SNAI2)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_jaz zf-C2H2_6 zf-met zf-Di19 zf-C2HE zf-BED zinc_ribbon_15 Elf1 zf-H2C2_5 Zn-ribbon_8 DUF4764 zinc_ribbon_9 Zn_Tnp_IS1595
Other DBs
NCBI-GeneID: 102059954
NCBI-ProteinID: XP_005435843
LinkDB
Position
Unknown
AA seq 268 aa
MPRSFLVKKHFNSSKKPNYSELDTHTVIISPYLYESYPVPIIPQPEILSSVAYNPITVWT
TTGLLPSPLPNDLSPLSGYPSSLGRVSPPPPSDTSSKDHSGSESPISDEEERIQSKLSDP
HAIEAEKFQCSLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRT
HTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKK
YQCKNCSKTFSRMSLLHKHEESGCCVAH
NT seq 807 nt   +upstreamnt  +downstreamnt
atgccacgctccttcctggtcaagaaacatttcaattcgtccaagaagccgaattacagc
gagctggacactcacacagtgattatatccccatacctatatgaaagctatccggtccct
atcataccacagccagagatcctgagctcagtagcttacaaccccattactgtgtggact
acaactgggctgctaccatctccgctacccaacgacctctctccgctttctggatacccc
tcatctttgggaagagtcagcccacctccaccttctgacacctcctccaaagatcacagt
ggttcagaaagtcccattagtgatgaagaagagagaatccagtccaagctttcagacccc
catgcaattgaagccgaaaagtttcagtgcagtttatgcaacaagacctattccactttc
tctgggttggccaaacacaagcagctgcactgtgatgcccagtctaggaaatcgttcagc
tgcaagtactgtgacaaggagtatgtcagcctgggagcgcttaagatgcacatcaggacc
cacacgctaccttgtgtctgcaagatctgcggcaaggctttctctagaccctggctactt
caaggacacattagaactcacactggagagaagccgttttcctgtcctcactgcaacagg
gcttttgcagacagatccaatctgagggctcacctgcagacccactcagatgtgaagaaa
taccagtgcaaaaattgctccaaaacattctccagaatgtctcttctgcacaaacatgag
gaatctggctgctgtgtagcacactga

DBGET integrated database retrieval system