KEGG   Falco cherrug (Saker falcon): 114014226
Entry
114014226         CDS       T02911                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04012  ErbB signaling pathway
fch04068  FoxO signaling pathway
fch04110  Cell cycle
fch04115  p53 signaling pathway
fch04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    114014226 (CDKN1A)
   04068 FoxO signaling pathway
    114014226 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114014226 (CDKN1A)
   04115 p53 signaling pathway
    114014226 (CDKN1A)
   04218 Cellular senescence
    114014226 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 114014226
NCBI-ProteinID: XP_027672412
LinkDB
Position
Unknown
AA seq 274 aa
MEPAAASGCWMLCPGRALPAGGGTGSTVCTFPILLRHTRLWWLTLVVLKLLPPKTLLKSQ
VSGPRMCAGRWRSPLGCLVVEPNPACPTLATGCFALVASVLALGLAGALPNTPVTCSAFL
PAATMPLSHSKAGQMQCSTKACRNLFGPVDHHQLKNDFEDLMRQHLEEVQERWNFNFETE
TPLEGQFKWERVFLAEQPSREVHSLVTGISSESRSSLVHKVPPKDHLGRICPEASQQSSE
VYRAGSPQGLKRRQTTMKDFYSSKRRMVPDKPKP
NT seq 825 nt   +upstreamnt  +downstreamnt
atggaaccggcggcagcatcaggatgctggatgctctgccccggcagggctttacctgct
ggagggggaacggggagcaccgtgtgcaccttccccatccttctgcgtcacaccaggctg
tggtggttgaccttggtcgtgctcaagcttctgccccctaagacactgctgaaatcccag
gtgtctgggcccaggatgtgtgctggcagatggaggtcccctctgggctgccttgttgtt
gagcccaacccagcctgtcccaccttggctaccgggtgctttgctctggtagcaagtgtg
ctggcccttgggcttgcgggtgccttgcccaacaccccagtaacttgttctgctttcctc
ccagccgccacgatgcccctgtctcacagcaaggctgggcagatgcaatgcagcaccaag
gcatgcaggaacctctttggccctgtggaccaccaccaactcaagaatgactttgaggac
ctgatgaggcaacacctggaggaagttcaggagcgctggaacttcaactttgagacagag
actcccttggaaggacagttcaagtgggagagggtcttcctggctgagcaaccgtcccgg
gaggtccacagcctggtcacgggcatcagcagtgagagcaggagctccttggtccacaag
gtcccccccaaggaccatcttggcaggatttgccctgaggcatctcagcagagctcggag
gtctacagggctggttccccacagggcctgaaacgtcggcagaccaccatgaaagacttc
tacagctccaagcggaggatggtccccgacaagcccaagccgtga

DBGET integrated database retrieval system