KEGG   Frederiksenia canicola: A4G17_00715
Entry
A4G17_00715       CDS       T06481                                 

Definition
(GenBank) hypothetical protein
  KO
K02847  O-antigen ligase [EC:2.4.1.-]
Organism
fcl  Frederiksenia canicola
Pathway
fcl00540  Lipopolysaccharide biosynthesis
fcl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fcl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    A4G17_00715
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:fcl01005]
    A4G17_00715
Enzymes [BR:fcl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     A4G17_00715
Lipopolysaccharide biosynthesis proteins [BR:fcl01005]
 Core region
  A4G17_00715
SSDB
Motif
Pfam: Wzy_C CsgE
Other DBs
NCBI-ProteinID: QIM64072
LinkDB
Position
154497..155741
AA seq 414 aa
MVPFIRRIEKKHIGWLINALVFSFFITVLTFKKGYSYAPMSLAIIGVVYLFYYLFVEKRK
LNPTREDKWLIFAFVFYFSTFALSAVIHGDGWREIDNPSRVLLFLPLLLLFRELPINIKI
ILYGIPLGSAIAGIVAIYHKFYLNLERPFPYLMHIQAGDIAISLAMMSLAISIYWGIKKN
YKWLVFCLIASGFGVLASALTGARGGWVGLPVVLGIILWFSYKNLNKKITIGISLTLGIL
ITTVVIVPKTNVMQRINKTHKEITNYVEKNHRHTSLGARFDMWKGASLGIKERPILGWGS
KGYIELKKQQIHNKVIHKATLQFNDAHNQYLDSFVKKGIFGLLSILTIIFTPLVFLYQRY
KSQSIEEKTLGLIGIIHIISCALFFTSQTFLAHNSGSIFYFFILFILPKKSNTK
NT seq 1245 nt   +upstreamnt  +downstreamnt
atggttccatttatccgtagaatagaaaaaaaacacattggttggcttattaacgctctc
gttttttctttttttattacggttctcacgtttaaaaaaggttatagctacgccccaatg
tcattagctattatcggtgttgtttatcttttttattatctatttgtagaaaaaagaaaa
ttaaacccgactagagaagataaatggcttatttttgcttttgttttttatttttcgacc
tttgctctttcggctgttattcatggtgatggctggcgggaaattgataacccaagcaga
gtgctattatttttgcctttgttattattgtttagagagcttccgatcaacattaagata
attttatatggtattcctcttggttctgccatagctggaatcgttgcaatttaccacaag
ttttatctaaatctagaaagaccatttccctatttaatgcatattcaagcaggtgatatt
gctatttcactggcaatgatgagtctcgctatttcaatttactggggaattaagaaaaat
tataaatggctagtattttgtctaatcgcatcaggatttggtgtattagcaagtgcctta
actggagcaagaggtggctgggttggattgcctgtcgtactgggtattattttatggttt
tcttataagaatttaaataaaaaaatcactattggaatttcattaaccctaggaatacta
ataactacggtagtgattgttccgaaaactaacgttatgcaaagaattaataaaacacat
aaagaaatcacaaactacgtggaaaaaaatcatcgacacacttctcttggggctcgattt
gatatgtggaaaggagcatctttaggaattaaagaaagaccaattttaggatggggaagt
aaaggatatatagaactaaaaaaacaacagattcacaataaagtaatccataaagcaaca
ttacaatttaatgatgcacataatcaatacctagactcttttgtaaaaaaagggattttt
ggtttgcttagtattctaaccatcatattcacaccactagtttttttatatcaaagatat
aaatcccaatccatagaagaaaaaacattagggctaattggaataatacacatcatatcc
tgtgctctattctttaccagtcaaacattcctagctcataattcgggaagtatattttac
ttttttatactatttatacttcctaaaaaaagcaatactaaatga

DBGET integrated database retrieval system