KEGG   Frederiksenia canicola: A4G17_04795
Entry
A4G17_04795       CDS       T06481                                 

Definition
(GenBank) S-ribosylhomocysteinase
  KO
K07173  S-ribosylhomocysteine lyase [EC:4.4.1.21]
Organism
fcl  Frederiksenia canicola
Pathway
fcl00270  Cysteine and methionine metabolism
fcl01100  Metabolic pathways
fcl01230  Biosynthesis of amino acids
fcl02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:fcl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    A4G17_04795
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    A4G17_04795
Enzymes [BR:fcl01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.21  S-ribosylhomocysteine lyase
     A4G17_04795
SSDB
Motif
Pfam: LuxS
Other DBs
NCBI-ProteinID: QIM64797
LinkDB
Position
complement(987885..988394)
AA seq 169 aa
MPLLDSFKVDHTKMNAPAVRVAKTMTTPKGDTITVFDLRFCRPNIDILPVRGIHTMEHLF
AGFMRDHLNSDSVEIIDISPMGCRTGFYMSLIGTPSPETVAKAWENAMLDALNKVPDESK
IPELNKFQCGSYKEHSLAEAHDIARNVLKQPIGINRNEDLALDEKWLNP
NT seq 510 nt   +upstreamnt  +downstreamnt
atgcctttattagatagtttcaaagttgatcatactaaaatgaatgcccccgcagtacgt
gttgcaaaaacgatgaccacaccaaaaggcgatacaattaccgtttttgacctgcgtttc
tgccgaccaaacattgatattctgccagtgcgtggcattcatacaatggagcatttattt
gctggttttatgcgtgatcatctcaacagcgacagtgtcgagatcatcgacatctcgcca
atgggctgtcgtacaggcttttatatgtcgctcatcggcacgccgtctccagaaaccgtg
gcaaaagcatgggaaaatgcaatgcttgatgcgttaaacaaagtgcctgacgagtctaaa
attccagaactcaacaaatttcaatgtggttcgtacaaagaacactctttagccgaagca
cacgacatcgcccgcaatgtgttgaagcagccaattggtatcaaccgtaacgaagattta
gccttagacgaaaaatggttaaatccataa

DBGET integrated database retrieval system