KEGG   Flavobacterium commune: BIW12_01680Help
Entry
BIW12_01680       CDS       T05006                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
fcm  Flavobacterium commune
Pathway
fcm00630  Glyoxylate and dicarboxylate metabolism
fcm01100  Metabolic pathways
fcm01120  Microbial metabolism in diverse environments
fcm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BIW12_01680
Enzymes [BR:fcm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BIW12_01680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AOZ98250
UniProt: A0A1D9P6Q9
LinkDB All DBs
Position
415485..416726
Genome map
AA seq 413 aa AA seqDB search
MERIFAEYYIETPYAVEQAAAVLAGEQSSGTFVSVPGETAELKQRFAARVENIEILDSAD
EPSIPGNSIPGKKYQRAKVKVSWSIENFGYNLPVLISTLQGNLYEISQFTGLKLMDFDVP
DSFKNKYRGPQFGIKGSKLSCGVSDRPMIGTIIKPSVGMSPDETAALVKTLIDAGIDFIK
DDELMGSTANSLFDDRVNVIMKVINNHAQKTGKKVMYAFNISDEIDEMQRKYDLIKKHEG
TCAMISINSVGLSATKKICDQGDLVIHGHRNGWGMLNRHPLLGIEFPAYQKIWRMAGVDQ
MHVNGIQNKFWESDDSVVTSIQSCLKPFIGENNPLPVVSSGQWGGQAPETYRRTQTTDLL
YMAGGGILAHPMGATAGVNALQQAWKAAVNGLSVEEAALQYPEFAASVKKFSK
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaatttttgcagaatactacatcgaaaccccttatgcagtagaacaagccgca
gcagtattggccggcgaacaatcatcgggaacttttgtatccgttccgggagaaaccgcc
gagctcaaacaacgctttgctgcccgcgtagaaaatattgaaatattagattcggctgat
gaaccttcgattccgggaaacagcattccaggaaaaaaataccaaagagctaaagttaag
gtgagttggtcgattgagaatttcggttataatttgcctgtgcttattagtactttacaa
ggaaatctatacgaaatcagtcagtttacaggtttaaaactaatggattttgatgttcct
gattcttttaaaaataaatacagaggaccacaatttggaatcaaaggttctaaattgtct
tgcggtgtgagtgacagacctatgattggtactattattaaaccaagtgtaggaatgagt
cctgatgaaactgctgctttagttaaaacattaattgacgctggtatcgattttatcaag
gatgatgaattgatgggatctaccgcaaactctctttttgacgaccgtgtaaacgttatc
atgaaggtaattaacaatcatgcgcaaaaaactggtaagaaagtaatgtatgcattcaac
atcagcgacgaaattgacgaaatgcaacgaaaatacgatttgatcaaaaaacacgaagga
acttgcgccatgattagcatcaatagcgtgggattgagtgctaccaagaaaatttgtgac
cagggtgatttggttatccacggacacagaaatggttggggaatgttaaaccgtcatccg
ttactgggaattgaattcccggcttatcaaaaaatatggcgtatggccggtgttgaccaa
atgcacgttaacggaatccagaataaattctgggaatccgatgattcagtggtgacttct
atacaatcgtgcttaaaaccatttattggtgaaaacaatcctttaccggtagtttcttca
ggacaatggggcggacaggcaccggaaacctatagaagaacccaaactaccgatttattg
tatatggcaggtggcggaattttagcacatcctatgggagcaacagcgggggtaaatgcc
ctgcaacaagcctggaaagctgccgttaatggcttatctgtagaagaagccgcattacaa
tatcctgaatttgcagcatcagtaaaaaaattctcgaaataa

DBGET integrated database retrieval system