KEGG   Flavobacterium commune: BIW12_03845Help
Entry
BIW12_03845       CDS       T05006                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
fcm  Flavobacterium commune
Pathway
fcm00564  Glycerophospholipid metabolism
fcm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fcm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BIW12_03845
Enzymes [BR:fcm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BIW12_03845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Thi4 Pyr_redox_2 HI0933_like GIDA NAD_binding_8 Pyr_redox_3 FAD_binding_3 S_100
Motif
Other DBs
NCBI-ProteinID: AOZ98638
UniProt: A0A1D9P7S2
LinkDB All DBs
Position
complement(885331..886884)
Genome map
AA seq 517 aa AA seqDB search
MNREEKFNQLRENTEFDIVIIGGGATGLGCAVDAASRGYKTLLLEKYDFAKGTSGRSTKL
VHGGVRYLAQGNIHLVREALLERGRMLRNAPHVCHKLGFVVPVYSWWDKWYYGFGLWIYE
FLSAKFSLGKTRILSKAATLKHLPDLDSTNLKGGVLYYDGQFDDSRLAINLAQTAIEYGA
LVLNYCAVSDFIKKDNKIIGLIAKDELSNQEYSIKAKAVVNATGVFADDLLQKAEGHAEV
TIAPSQGIHLVLNKSYFEGSSAMLIPKTSDGRVLFVIPWHDKIVLGTTDTPVKEVALEPK
PLEEEIHFIINHFNKYSKHKIDYADLNSVFVGLRPLVKVGAEKKTALLSREHSIKVLSSG
LINVTGGKWTTYRSMAEQTINKAIQASGLKFVRCKTRRLQIHGYSKEKTNSHFAIYGSDA
HLIQQIIAADVSLSEKIHPDYPYTKAEVVWVVKNEMALTVEDVLARRIRLLFLDARAAIQ
AAPVVAEIMAFLLGKNTEWKEEQIVLFHELAEGYLVK
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgaatagagaagaaaagtttaatcaacttcgtgaaaataccgaatttgatatcgttata
attggtggaggagctactggcctcggttgtgctgttgatgctgccagtcgtggatataag
accttgcttttggagaagtatgattttgccaaaggaacttccggcagatctacaaaatta
gttcatggcggagtaaggtatttggctcagggcaatattcatttggttcgggaagctttg
ctggaacgcggtcgaatgcttagaaatgcaccgcatgtttgtcataaattaggatttgta
gtaccggtatattcgtggtgggataaatggtattatggttttggtttgtggatttacgag
tttttgtcggctaaatttagtctgggaaaaacacgaatactttcaaaagcagctacttta
aaacatttgcctgatttggattcgaccaacttaaaaggaggcgttttgtattatgatggg
caatttgatgatagtcgattggcaattaatttagctcaaaccgcaattgaatatggagca
ctagtgttgaattattgcgcagtttctgattttataaaaaaggacaataagataattggt
ttaattgcaaaagacgaattatcaaatcaggaatatagtattaaagcgaaggcagttgtt
aatgcaactggtgtttttgcggatgatttactgcaaaaggcggaaggacatgcagaagta
accattgcgccatcgcaaggaattcatctggtattgaataagtcttattttgaaggttct
tcggcgatgttgattcctaaaacgtctgatggcagggttttgtttgtaattccctggcat
gataaaatagtgttaggtactaccgatactcctgttaaagaagtagcattggagccaaaa
ccattggaagaggaaattcattttatcatcaatcattttaataaatattcgaaacataaa
attgattatgctgatctaaatagtgtttttgtaggtttgcgtccgttggtgaaagtaggt
gctgagaaaaaaacagctttgttgtcaagagagcatagtattaaagtactttcttctgga
ttgattaatgtgactggaggcaagtggactacttatagaagtatggccgaacagactatc
aataaagcaattcaggcttcgggattgaaatttgtcagatgtaaaaccagacgtttgcaa
atacacggatattcaaaagaaaaaacgaattcccatttcgcaatttatggttctgatgct
catttgatacaacaaataattgctgctgatgtttctttatctgaaaaaattcatccagac
tatccttatacaaaagcagaagtagtttgggtagtaaaaaacgaaatggctctaactgtt
gaggatgttttagcaagaaggatcagattgctttttcttgatgcaagagcggcaatccag
gctgctcctgttgttgcagaaataatggcttttttgttaggaaaaaatactgagtggaag
gaggagcaaattgttttgtttcatgaattagctgaaggatatttggtaaaataa

DBGET integrated database retrieval system