KEGG   Flavobacterium commune: BIW12_07190Help
Entry
BIW12_07190       CDS       T05006                                 

Definition
(GenBank) glycoside hydrolase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
fcm  Flavobacterium commune
Pathway
fcm00052  Galactose metabolism
fcm00511  Other glycan degradation
fcm00600  Sphingolipid metabolism
fcm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fcm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BIW12_07190
  Lipid metabolism
   00600 Sphingolipid metabolism
    BIW12_07190
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BIW12_07190
Enzymes [BR:fcm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BIW12_07190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_N Glyco_hydro_2_C DUF4982 Glyco_hydro_2
Motif
Other DBs
NCBI-ProteinID: AOZ99242
UniProt: A0A1D9P9N3
LinkDB All DBs
Position
1727895..1730330
Genome map
AA seq 811 aa AA seqDB search
MNLHKSVLQKGTIAIALLFLVACASTKKESRIIADFNPDWNFKLGDYPTAIQANFDANDW
RTLDLPHDWSIEGAFNKDNPTKQAQAFLPAGKGWYRKTFTLPEDWKNKNVSIEFDGVFKN
SEVFINGHSLGMRPNGYISFAYELSQYLNFGTQKNIIAVKVDNDAQPNSRWYTGSGIYRN
VRLVASEKLHVAKWGTYVTTRGITKDKAIVDIDVDVKNGLGTNKLFKLVSTILDKNNVEV
AKAISDGNIPANSILQVKQNTKIENPILWDTENPYLYKIVTKVYDGSTVVDTYETPLGVR
YFNFDAEKGFSLNGKPTKILGVCLHHDNGALGAVENIHAVKRKLKILKEMGTNAIRMSHN
PHSLEMMKLCDEMGFIVQDEFTDVWKKKKVTNDYHKDWDAWHKQDLEDFIKRDRNHPSVM
MWSIGNEIREQFDSTGIAITRELAQIVKSLDTTRPVTSALTENVIEKNFIYQSGALDLLG
FNYKHEDYKDFPTKFKGQKILASESVSALETRGHYDMPTDSIRMWPTKHNAPFDGNADLT
VTAYDNIASYWGTTHEENWKTIKKQDFMAGTFIWTGFDYLGEPDPYPYPARSSYFGIVDL
AGLPKDVYYMYQSEWSDKDVLHLLPHWNWKQGQMIDVWSYYNNADEVELLLNGKSLGSKA
KKGEELHIAWKVPFEAGTLKAISRKEGKIVKETEIHTAGEAVKIDLKSDKTSIKNDGYDL
VYVTVSLQDKDGNLLPKADNLINFKVSGGAKIVGVDNGYQASLEPFKADYRKLYNGKCVV
ILQSNKKAENITLEATTAGNISLGTVSIKVE
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacataaaagtgttttacaaaaaggaacaatagcaattgcgttgttgttcttg
gttgcctgtgcatcaacaaaaaaagaaagccgaataatagctgattttaatccggattgg
aattttaaattaggcgattatccaacggcaatacaggctaattttgatgcgaatgattgg
cgtacgttagatttaccgcacgattggagtatcgaaggtgcgtttaataaagataatcca
accaaacaggctcaggcatttttgccggcaggaaaaggctggtaccgaaaaacatttaca
cttcccgaagattggaagaacaaaaacgtttcgattgaatttgacggcgttttcaaaaac
agcgaagtattcattaatggacattcgttaggaatgcgcccaaatggatacatttcattt
gcctacgaattgtcacaatacctgaactttgggacccagaaaaacatcatcgctgtaaaa
gttgataacgatgcacaacccaattccagatggtacaccggttccggaatttacagaaat
gtgcgattggttgccagcgaaaaacttcacgtagcaaaatggggaacgtatgtaactacg
cgtggaatcaccaaagataaagctattgttgatattgatgttgacgtgaaaaatggtttg
gggaccaataaactttttaagttagtttcgacaattttagataagaataatgttgaagtt
gcaaaagcaatctctgatggaaatatcccagcaaattcaattttacaagttaaacaaaac
actaagatagaaaacccaattctttgggatactgagaatccgtatttatacaagatagta
acaaaggtttatgatggttcgactgtagttgatacttatgaaacaccgcttggagttcgt
tatttcaatttcgatgccgaaaaaggattttcgttaaatggaaaacctaccaaaatatta
ggcgtttgcctgcatcatgataacggtgctttgggcgctgtggagaatattcatgctgtc
aaaagaaaattgaaaatcctgaaagaaatgggaaccaatgccatcagaatgtcgcacaat
ccgcattctttggaaatgatgaagctgtgtgatgagatgggatttattgttcaggatgag
tttaccgatgtctggaaaaagaaaaaagtcaccaatgattaccataaagactgggatgct
tggcacaaacaggatctggaagattttatcaaaagagaccgcaaccatccttcggtaatg
atgtggagtattgggaatgaaatcagggaacaatttgacagtactggaattgctattacc
agagaactggctcaaatcgtaaaatcgctggataccactcgtccagttacgagtgctttg
accgagaatgttattgagaaaaatttcatttatcagtcgggcgctttggatttattggga
ttcaattacaagcacgaagattataaagatttcccaaccaaatttaaaggacaaaaaata
cttgcttccgaaagtgtttcggcactggaaacccgtggtcattatgatatgccaactgat
tccataagaatgtggccaacaaaacacaatgccccttttgatggcaatgctgatttaacg
gttacggcttatgataatattgcttcttactggggaacgacacatgaagaaaactggaaa
actatcaaaaaacaggattttatggcggggactttcatttggacaggcttcgattatctg
ggcgaacctgatccgtatccgtatcctgcacgtagttcgtattttggaatcgtagatttg
gcgggcttgcctaaagatgtgtattatatgtaccaaagcgaatggagtgataaagatgtg
ttgcatttattgccacattggaactggaaacagggtcaaatgattgatgtttggtcgtat
tacaacaatgctgatgaagttgaattattgttaaacggcaaatctctaggttcgaaagct
aaaaaaggagaagaattgcacattgcctggaaagtgccttttgaagcaggaactttgaaa
gcgatttccagaaaagagggtaaaatagtgaaggaaaccgaaattcataccgctggcgaa
gcagttaaaatcgatttgaagtcggataaaacgagtattaaaaacgatggatatgatttg
gtttacgtaacggtttctttgcaggacaaagacggaaatctacttccaaaagccgataat
ctaattaactttaaagtttctggtggtgctaaaattgttggtgttgacaatggctaccaa
gccagtttagaaccttttaaagccgattatcgaaaattatataatggaaaatgtgtagtg
attttgcaatcgaataaaaaagcagaaaacataactcttgaagctactacagcaggaaat
atcagcttaggtactgtgagtattaaagtagaataa

DBGET integrated database retrieval system