KEGG   Flavobacterium commune: BIW12_07750Help
Entry
BIW12_07750       CDS       T05006                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
fcm  Flavobacterium commune
Pathway
fcm00240  Pyrimidine metabolism
fcm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fcm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BIW12_07750
Enzymes [BR:fcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BIW12_07750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22
Motif
Other DBs
NCBI-ProteinID: AOZ99344
UniProt: A0A1D9PAJ2
LinkDB All DBs
Position
1859627..1860217
Genome map
AA seq 196 aa AA seqDB search
MFLENTVNHKEQFGWIEVICGSMFSGKTEELIRRLKRAQFAKQKVEIFKPEVDTRYHQDM
VVSHDANEIRSTPVPAAANIAILAQGCDVVGIDEAQFFDDEIVTVCNDLANQGIRVIVAG
LDMDFKGNPFGPMPALMATAEYVTKVHAVCTRTGNLAHYSFRKTANDKLVLLGETEEYEP
LSRAAYFEAMQKSQED
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcgaaaatacagtaaatcataaagagcaatttggttggattgaagttatttgc
ggttcgatgttttcgggtaaaacggaagaattgattcgtcgattaaaaagagcacagttt
gccaaacaaaaagtagaaattttcaaaccggaagtcgatacccgttaccatcaggatatg
gtagtttcccatgatgccaatgaaattcgttccacaccggttcccgcagcagctaatatt
gctattctggctcagggctgtgatgtagtaggcattgacgaagcccagttttttgatgac
gaaattgtgactgtttgcaatgatttagctaaccagggaatccgtgttattgttgccgga
ttagacatggatttcaaaggaaatccttttggtcccatgccagctctgatggcaacagcc
gaatatgtaactaaggttcatgcggtgtgtacccgaacaggtaatttggcgcattatagt
ttcagaaaaacagccaatgataaattagtcttgttaggagaaacagaggaatacgagccc
ttaagtcgtgcggcatattttgaagccatgcagaaaagtcaggaagattaa

DBGET integrated database retrieval system