KEGG   Flavobacterium commune: BIW12_14225Help
Entry
BIW12_14225       CDS       T05006                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
fcm  Flavobacterium commune
Pathway
fcm00620  Pyruvate metabolism
fcm00680  Methane metabolism
fcm01100  Metabolic pathways
fcm01120  Microbial metabolism in diverse environments
fcm01200  Carbon metabolism
Module
fcm_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:fcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BIW12_14225
  09102 Energy metabolism
   00680 Methane metabolism
    BIW12_14225
Enzymes [BR:fcm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BIW12_14225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: APA00485
UniProt: A0A1D9PDS9
LinkDB All DBs
Position
3434985..3437567
Genome map
AA seq 860 aa AA seqDB search
MYTLPKIERFKQNVLSKYNIYNSVFITLPFDSIDNTGALLPLFTEVCETGFRKMETPKEI
FEFFSKKYLHTDVEADKIDLMFRFIQYIERQIVLFDAIEDAAFPIVNNMEGRGSLRDIKE
KADARGKNEELVEFLENFNVRPVLTAHPTQFYPGAVLGIINDLTQAIRDNNLLQIKQLLA
QLGKTPFIKNEKPNPFDEAVSLIWYLENVFYNTAGDMMHYLETNISPEGIKNPIIQLGFW
PGGDRDGNPFVTTDITLKVADRLRTSILKCYYFEMRDLKRKLTFPGVDVLVAELENKLYR
SVFYSRGEIYITLEEFKSQLIKIKTIIVEQHQSLYLDELEALLIKINLFGFHFATLDIRQ
NSKIHDAVFKDVFDFYLEKGENVFPKNYYELSENEKIEVLANAKGDLNPEDFKNDMTKST
LESIRAIQQIQTANGELGANRYIISNNENAVNVLEAFALFRLNNWEFPSVDIVPLFESVD
DLQNAHNVMEQLYTNPVYAAHVASRGMKQTIMLGFSDGTKDGGYLMANWSIYQAKEQLTA
MSRKYGVKVIFFDGRGGPPARGGGKTHKFYASLGPNIENKEIQVTVQGQTISSNFGTLDS
CRHNLENLLSAGVTNQVFNKDLNKLSDEDKEVMNQLSELGYKKYLSFKNHDKFIPYLEKM
STLKYYAKTNIGSRPSKRSKSEKLDFKDLRAIPFVGSWSQLKQNVPGFYGVGAALKHFEE
TNQWDKVQALYDSSMFFKTLLENSMMSLAKSFFPLTAYMKNDPEFGEFWQNIYDEFLETK
RLLLKIAGHKELMENYPDGIASIQVRERIVLPLLTIQQYALLRINELNKEANPDDKLIKV
YEKIVMRSLFGNTNASRNSA
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atgtacacgctccctaaaattgaacgttttaaacaaaatgttctttctaaatataatatt
tacaacagcgttttcattactttaccttttgattctatagacaatacaggtgctttactg
cctttgttcacagaggtttgtgaaacaggttttagaaaaatggaaacaccaaaggaaata
tttgagtttttctctaaaaaatatttacatactgacgtagaggccgataaaattgattta
atgtttcgttttatccagtatatcgaacgtcaaattgtattgtttgatgctatagaagac
gcagcttttcctattgtaaataatatggagggacgtggttctttgagagatattaaagaa
aaagcggatgccagaggaaaaaatgaagaattagttgagtttttagaaaattttaatgta
agacctgttttaacggcgcatcctacacagttttatccaggtgctgttttaggaattatt
aacgatttgactcaggcaattcgtgataataacttacttcaaatcaaacagcttttagcg
caattaggaaaaactccgtttatcaaaaatgaaaaaccaaatccttttgacgaggcagta
agtttgatttggtatttggaaaatgtattttataacaccgctggtgatatgatgcattat
ctggaaactaatatttctccggagggaattaaaaatccgattatccaacttggattttgg
ccgggaggagacagagatggaaatccatttgtaactactgatattactctaaaagttgct
gaccgtttaagaacttctattttaaaatgttattattttgaaatgagagacttaaaaaga
aagttaacttttcctggtgtagatgttttagttgctgaacttgaaaataaactatatcgt
tctgttttttattcaagaggtgaaatctacattaccttagaagagtttaaatctcaatta
attaagataaaaaccattattgtagagcaacatcagtctttatatcttgatgaattagaa
gctttgcttatcaaaataaatctgttcggattccattttgctactttagatattcgtcaa
aacagcaagattcacgatgctgtatttaaagatgtattcgatttttatttagagaaagga
gaaaatgtttttcctaaaaattattacgaattatcggaaaatgagaagattgaagtttta
gcaaatgcaaaaggagatttgaatcctgaagactttaagaacgatatgaccaaatcgact
ttggagtctattcgtgcaatccaacaaattcaaacagctaatggcgagttaggagctaac
cgttacattatcagtaacaatgaaaatgcggtaaatgtcttagaagcatttgctttgttt
agattaaataattgggaattcccttcagtagatattgtgcctttatttgaatcggttgat
gatttgcaaaatgcacataatgttatggagcaattatatacaaatccggtttatgctgcg
catgttgcaagcagaggaatgaagcaaactatcatgcttggattctctgacggtacaaaa
gacggaggttatttaatggctaactggagtatctatcaggctaaagagcagcttactgct
atgtccagaaaatatggtgtaaaagtgatattttttgacggacgtggtggaccaccagct
cgtggaggaggaaaaacacataaattctatgcttctttaggaccaaatatcgaaaacaaa
gaaattcaggtaactgttcagggacagaccattagttctaattttggaactttagattct
tgtcgtcataacttagaaaatttattaagtgccggagttaccaatcaggtatttaataaa
gatttgaataaattatctgatgaagataaagaggtaatgaaccagttatcggaattagga
tataaaaaatatttaagctttaagaatcacgataaattcattccgtacttagagaaaatg
agtacgttgaaatattatgccaaaactaatatcggaagtcgtccttcaaagagaagtaag
tctgaaaaattagattttaaagatttaagagcaattccatttgtggggtcctggagtcag
ttgaagcaaaatgttcctggattttatggagtaggagctgctttaaaacattttgaagaa
acaaatcaatgggacaaagttcaggcattgtatgatagttcaatgttcttcaaaacattg
cttgaaaacagtatgatgtcattggctaaatcatttttcccattaacggcttacatgaaa
aatgatcctgaatttggagaattctggcaaaatatctacgatgaatttttggaaaccaaa
agattgttgttaaaaattgccggtcataaagagttaatggagaattatcctgacggaata
gcttcaatccaggtgagagagcgtattgtattacctttattgacaattcaacaatatgct
ttgttgcgaattaatgaattgaataaagaagctaatccggatgataaattaatcaaagtg
tacgaaaaaatcgtaatgcgttctttgtttggaaatactaatgctagtagaaattcagct
taa

DBGET integrated database retrieval system