KEGG   Francisella hispaniensis 3523: FN3523_0547Help
Entry
FN3523_0547       CDS       T02078                                 

Definition
(GenBank) Cell division protein FtsI (Peptidoglycan synthetase)
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
fcn  Francisella hispaniensis 3523
Pathway
fcn00550  Peptidoglycan biosynthesis
fcn01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:fcn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    FN3523_0547
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    FN3523_0547
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:fcn01011]
    FN3523_0547
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fcn03036]
    FN3523_0547
Enzymes [BR:fcn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     FN3523_0547
Peptidoglycan biosynthesis and degradation proteins [BR:fcn01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   FN3523_0547
Chromosome and associated proteins [BR:fcn03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    FN3523_0547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AEB28404
UniProt: F4BJR0
LinkDB All DBs
Position
554554..556152
Genome map
AA seq 532 aa AA seqDB search
METIQYPKLKQEGDNRSDRSIDIKAYRGIIVDRNGNPLAISTPVDTIWVDPFYVSADSPK
LNKIMDILNLSEKTREKIKRQVKVREGRSGFVYIERKVQPYLSQKVKDLDVTGIHVIREF
KRYYPMAEVASHIVGFTNVDGKGQEGLELEFNKFLSGQDGYFEYKKDLHGGVASKVEDKY
VDPKNGHNLQISIDSRLQYIAYKYLKEGVIRTNSEAGSVIVEDIHTGEILAMANYPSYNP
NSMADAYPDRRRNRAITDVYELGSVMKTFAAATALTYGDNVTADEPVIDTHPGFYRIGKN
TVRDERDYGDINLRHILMKSSNVGISKMILGLTEPSILESSLRNFGFGSKTGIKLPGERD
GYVPTKDKWGDFQLATLSFGYGMNATDLQLIAGVSAIANNGQYIKPTILKRRPGEEIETR
PIISEKNSKEMISMMQSVVEDLGGTGSKAQIPLYHVAGKTGTARMLSGGSYGAKYLASFV
GIVPATDPKLAIVVTIKDPKGDQYGGGAVAAPVFADVALNSLQILGVKPDKI
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggaaactatccaataccctaagcttaagcaagaaggtgataaccgcagtgatagaagt
atagatataaaagcgtacagaggtataatcgttgatagaaatggtaatcctttggcaata
agtactcctgttgatacaatttgggttgatcctttttatgttagtgccgatagccccaag
ctaaataaaattatggatatcttgaatctatctgaaaaaactagagaaaaaataaaaaga
caagttaaggttagagaaggaagaagtggttttgtctatattgagagaaaggttcaacca
tatttatcacaaaaagttaaggatcttgatgttacaggtattcatgtaataagagagttt
aaacgttattatccaatggctgaggtggcatcacatattgtaggtttcactaatgttgat
ggtaaaggtcaagagggtttagaacttgagtttaataagtttttaagtggtcaagatggc
tattttgaatacaaaaaagatcttcatggtggagttgcttctaaggttgaggataaatat
gttgatcctaagaatggtcataatctacagataagtattgactctaggctacaatatatt
gcatataaatatctcaaagaaggagttattaggactaactctgaagcaggttctgtgata
gttgaagatattcatactggcgagatattagcaatggcaaattatccttcgtataatcct
aacagtatggctgatgcctatcctgataggagaagaaatagagctattacagatgtctat
gagttaggttcggtaatgaaaacttttgcagcagcgacagctctaacttatggtgataat
gtaactgcagatgagcctgtaattgatactcatccaggattctatcgtattggtaaaaac
acagtaagagatgagcgagattatggtgatattaatctaagacatatcttaatgaaatct
agtaacgttggtatctcgaagatgattttaggtttgacagagccaagtatattagagtca
tcattaagaaattttggttttggtagtaagactgggataaaactacctggtgaaagagat
ggttatgttccaactaaagataaatggggtgatttccaactagcgacattatcttttggt
tatggtatgaatgctactgatttgcagctaatagctggtgtatctgcaattgctaataat
ggtcagtacatcaagccaactatcctaaaaagaagacctggagaagagatcgaaacaaga
cctatcatatcagagaagaattcaaaagaaatgataagtatgatgcagtctgtagttgaa
gacctaggaggaactggttctaaagcgcaaattcctctttatcatgttgctggcaaaaca
ggtacagctaggatgctttctggtggtagttatggagcaaaatatttagcaagtttcgtt
ggtattgttcccgcaactgatcctaaactagctatagtcgtgacaatcaaagatcctaaa
ggtgatcaatatggtggtggtgctgtagctgctccagtttttgcagatgttgcattaaat
agcttgcaaatactaggcgttaagccagataagatttga

DBGET integrated database retrieval system