KEGG   Francisella hispaniensis 3523: FN3523_0581Help
Entry
FN3523_0581       CDS       T02078                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
fcn  Francisella hispaniensis 3523
Pathway
fcn00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:fcn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    FN3523_0581
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fcn01002]
    FN3523_0581
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:fcn01011]
    FN3523_0581
Enzymes [BR:fcn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     FN3523_0581
   3.4.21  Serine endopeptidases
    3.4.21.-  
     FN3523_0581
Peptidases and inhibitors [BR:fcn01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   FN3523_0581
Peptidoglycan biosynthesis and degradation proteins [BR:fcn01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   FN3523_0581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2 Peptidase_S11 DUF2683
Motif
Other DBs
NCBI-ProteinID: AEB28438
UniProt: F4BJU4
LinkDB All DBs
Position
complement(587819..589213)
Genome map
AA seq 464 aa AA seqDB search
MYTKLPRSLLLFFILVPFIAYPLAVNSIELNQVLDNSIKQNNLQSAQIAVKIIDSQKNTV
ILSRNADKNFVPASNTKLLTGIAGLLFLGKDFRFETKLYYDKITNHNIDNLYIEFSGDPS
FTREDLHKLLISLHKNNIKNINNIYFVNHYFEGRDTPINQSNTSSIFGYGAPSSIYNLNE
NKITLQLTPSLNTFKVTQTSGERINFINNLFIASVEQLKTCQFNAYYKDNTLILSGCLPS
NSYNFSFATEDPQQLMQQTVLAELAQLKISLNNQIITTNKLPDNLTLLAKHKSVDLVKLL
KYMLLTSDNLYAQTITRTIGYYYNQVGSIVSGKNAIIEILKTKLKLDTDSIQIEDGAGMS
ENNLLSADFITELLQKMSQNKSFELFKSLLPIYGETGTLKNRSSKLLKGKVFAKTGTETT
AVTLSGYLYANSKQYIFSILINNLKNSQKSNALVLEKDLLESIC
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgtatacaaaattacctagatcattattattattttttatattagtaccctttatagca
tacccactagcagtaaattcaatagaattaaaccaagtattagataactctataaagcag
aataaccttcagtcagctcagattgcagttaagattattgactctcaaaaaaatactgtg
attttgtcaagaaatgccgacaaaaacttcgtacctgctagcaatactaaattacttact
ggaattgcagggttattgtttcttggtaaagattttaggttcgaaactaagctatattac
gacaaaattactaatcataatattgataatctttatattgagttttcgggggatccaagt
tttactcgtgaagacttacataaactcttgataagcttacacaaaaacaatataaagaat
ataaacaatatctattttgtaaaccactactttgaaggtcgtgatacaccaattaatcaa
agtaatactagctctatatttggctatggtgctccaagctcaatatataatttaaatgaa
aataagataactttacaactcacacccagcttaaatacttttaaagtaacccaaacttct
ggtgaaagaattaactttatcaacaacctttttatagctagtgtagagcagctaaagacc
tgtcagtttaacgcctattataaagataatactctgatacttagtggctgtttaccttca
aatagttacaattttagttttgctaccgaagatccacagcaactcatgcaacaaactgtt
ttagctgaactagcacaacttaaaatctcattaaataatcagataataacaactaataag
ctacctgataatctaacacttttagcaaagcataaatcagtagatttagttaaactatta
aagtacatgcttttaacatccgataatctctatgctcaaacaattacaagaactattggt
tactattataatcaagttggcagtattgtatctggtaaaaatgccattattgaaatacta
aaaactaagcttaaacttgacactgatagcattcaaatcgaagatggtgctggaatgtct
gagaataatttattatctgctgattttattactgaactgttacaaaaaatgtcacaaaat
aagagctttgagctttttaaaagtttactgccaatatatggagaaactggcacacttaaa
aatcgctcaagcaaactattaaaaggtaaagtatttgcaaaaactggaactgaaacaact
gccgttactctttcaggttatctctatgctaatagtaaacaatatattttttcaatactg
attaataatctcaaaaactcacaaaaatcaaatgctttggttttagagaaagatttgctt
gagagcatctgttaa

DBGET integrated database retrieval system