KEGG   Flavobacterium columnare: FCOL_01370Help
Entry
FCOL_01370        CDS       T01653                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
fco  Flavobacterium columnare
Pathway
fco00240  Pyrimidine metabolism
fco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    FCOL_01370
Enzymes [BR:fco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     FCOL_01370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22
Motif
Other DBs
NCBI-ProteinID: AEW85123
UniProt: G8X972
LinkDB All DBs
Position
328930..329556
Genome map
AA seq 208 aa AA seqDB search
MFLENTVNPKEQFGWIEVICGSMFSGKTEELIRRLRRAQFAKQKVEIFKPSIDTRYHEEM
VVSHNKNEIRSTPVPAAANIRILAQGCDVVGIDEAQFFDEEIVSVCNDLANAGVRVIVAG
LDMDFKGNPFGPMPALMATAEYVTKVHAVCTKTGNLAHYSHRKTANDSLVLLGETEEYEP
LSRAAYFNAMRNHIDVIDEQIIKKEEDK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgtttttagaaaatacagtaaacccaaaagaacaatttggatggattgaagtaatctgt
ggttcaatgttttccggaaaaacggaagaattaatccgtagattaagaagggctcagttc
gctaagcaaaaagttgagatatttaaacctagtattgatacacgttatcatgaagagatg
gttgtttctcataataaaaatgaaattcgttctacacctgttccagccgcggctaatatt
cgtattctagcacaaggttgtgatgtagtaggaattgatgaagcccaattttttgatgaa
gaaatcgtttctgtttgtaatgacttggcaaatgcaggggttagagtaattgtagcagga
ttagatatggattttaagggaaacccttttggtcctatgcccgctctaatggctactgcg
gaatacgttactaaggtacatgccgtatgtacgaaaacaggaaatttagcacattatagt
catagaaaaacagctaatgatagtttggttcttttaggagaaacagaagaatatgagcct
ttaagtagagctgcttattttaacgctatgcgtaatcatatagacgtaatagatgaacaa
attataaagaaagaagaagataaataa

DBGET integrated database retrieval system