KEGG   Flavobacterium columnare: FCOL_01375Help
Entry
FCOL_01375        CDS       T01653                                 

Definition
(GenBank) putative bifunctional UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase/alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
fco  Flavobacterium columnare
Pathway
fco00473  D-Alanine metabolism
fco01100  Metabolic pathways
fco01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:fco00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    FCOL_01375
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    FCOL_01375
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:fco01011]
    FCOL_01375
Enzymes [BR:fco01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     FCOL_01375
Peptidoglycan biosynthesis and degradation proteins [BR:fco01011]
 Precursor biosynthesis
  Racemase
   FCOL_01375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: AEW85124
UniProt: G8X973
LinkDB All DBs
Position
329556..332000
Genome map
AA seq 814 aa AA seqDB search
MALVLKQIVTALSCEFIEVDSSILIDTVSVDSRSHQNADSTLFFALIGPHHDAHQYIETL
IEQGVKSFVVQTINEKWLGKANFLKVANTLEALQLLATYYRNLFSFPVIGITGSNGKTIV
KEWLNFLLSPDYTIIRSPKSYNSQVGVPLSVIGINEMHNLGIFEAGISTVNEMQNLQKII
QPTIGILTNIGSAHDQGFIDIYEKIKEKLKLFKEVEILILNKNKTIEAFLDPSIKTFTWS
IENKEADVFFEKKEIEQHTDLKVIYKEHCFEISLPFIDEASLENSMHCVLTMLYLGYNDG
VIKDRIAQLYPVEMRLKVKTGIYNSTLIDDSYSSDFQSLKIALDFLQNQNQNPKKTLIIS
DIFQSGLTNEELYSRIAQLIIFNKITKVICIGNRITKYKNKFQNAISFESTASFVNAFDT
LDFSDETILIKGARVFEFEKIVSLLEEKKHETVLEINLNSLSHNFNYYKTKIKPTTKIMG
MVKAFGYGSGSFEIAKLLAHHKVDYLGVAFADEGIELKKAGIEVPIMVMNPEMTSFRSII
QYGLEPEIYSLRGLKAFLKILEEKKQNHYPIHIKINTGMNRLGFDEEIIPELISILKQNK
RIQVNTILSHFAESDNDADRTFSLNQINLFDRLSKQIIEVLEYNPIRHICNSSGISNYPE
GEFDMVRLGVGMYGVSNDLNEMKYLETVGTLKSVISQIRTLKIGDTVGYNRRFVVEKPTR
MAVIPIGYADGISRKWGRGVGYLLVNGEKAPILGSICMDMLMIDVTNISCAEGNEVVVFG
KDLPVTVIANAIDTIPYEILTGISRRVSRIFYRE
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atggcactggtacttaaacaaattgtaacagcattgtcttgtgaatttatagaagttgat
agttctattctaattgatactgtttcagtagatagtcgatcacatcaaaatgcagattca
acacttttttttgctctcattggcccccatcatgatgcacatcagtatatagaaactctt
atagaacaaggggtgaaatcatttgtagtacagactattaatgaaaaatggttgggtaaa
gctaattttttaaaagtagctaatactttagaagccttgcaattattggctacttattat
agaaatttattttcatttcctgtaataggaattacaggaagtaatggcaaaacaattgta
aaagaatggttaaactttttgttaagtccagattatacaattataagaagtccaaaaagt
tataactctcaagttggagttcctctttcggtaatagggatcaacgaaatgcacaattta
ggtatttttgaagcagggatttctactgtaaatgaaatgcaaaatttgcaaaaaataatt
caacctactattggaattttaacgaatataggttcggctcacgatcaaggttttattgat
atttatgaaaaaataaaagaaaaattaaagctttttaaggaagtagaaattctaattttg
aataaaaataaaacaattgaagcttttttagatccatccataaaaacttttacatggagt
atagaaaataaagaagcagatgttttttttgaaaaaaaagaaatagagcagcataccgat
ttaaaagttatttataaagaacattgttttgaaataagtctcccttttatagatgaagct
tctttagaaaatagtatgcactgtgttttgactatgttgtatctggggtataatgatgga
gttattaaggacagaatagctcaattatatcctgtagaaatgcgattgaaagttaaaacg
ggtatttataatagcactttaatagatgatagttatagttctgattttcagtcgttaaaa
atagcattggattttttgcaaaatcaaaatcaaaacccaaaaaaaactttaattatttcc
gacatttttcagtcaggattaacgaatgaagaactttattctagaatagcacaattaatt
atatttaataaaatcacaaaggtcatttgtattggaaatagaattaccaaatacaagaat
aaatttcagaatgctatttcttttgaatcaacggcttcttttgtaaatgcttttgatacc
cttgatttttcagacgaaaccattttgattaaaggagctcgtgtttttgaatttgaaaaa
attgtttctttattagaagaaaaaaagcatgaaaccgttttagaaattaatttaaattca
ttaagtcataacttcaattattacaaaactaaaatcaaacccacgactaaaataatgggt
atggtaaaagcttttggttacggaagcggaagttttgaaatagcaaaattattagctcat
cataaagtagattatttaggggtagcttttgcagatgaaggaattgagttaaaaaaagca
ggaatagaagtccctattatggttatgaatccagaaatgaccagttttagatctattatt
caatacgggttggaacctgaaatttacagtttacgaggtctgaaagcttttctaaaaatt
ttagaagaaaaaaaacaaaatcactatccaattcatattaagataaatacagggatgaat
cgtttgggttttgatgaagaaataatacctgaattaatatctatattaaaacaaaataaa
aggattcaggttaatactattttatcccattttgccgaaagtgataatgatgcagataga
acatttagtttgaatcaaataaacttatttgatcgcctttctaaacaaattatagaagta
ttagaatacaatccgatccgtcatatttgtaattcctcaggaattagtaattatcctgaa
ggcgagtttgatatggttcgtttaggagtagggatgtatggcgtttctaatgatctaaat
gaaatgaaatatttagaaactgtaggtaccttaaaatctgttatttctcaaatacgaact
ctaaaaataggggataccgttggatacaatagacgttttgttgtagaaaaaccaacacgt
atggctgtaattcctattggttatgcagatggaatatctagaaaatggggtagaggcgta
gggtatcttttagttaatggagaaaaagcacctattttgggaagtatttgtatggatatg
cttatgatagatgttaccaatatatcctgtgcagaaggtaatgaagtagttgtttttgga
aaagatctacctgtaactgttattgcaaacgctatagatactattccgtatgaaatacta
acaggtatttcgcgtcgagtgtcgagaattttctacagggaatag

DBGET integrated database retrieval system