KEGG   Flavobacterium columnare: FCOL_03430Help
Entry
FCOL_03430        CDS       T01653                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
fco  Flavobacterium columnare
Pathway
fco00380  Tryptophan metabolism
fco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    FCOL_03430
Enzymes [BR:fco01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     FCOL_03430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AEW85528
UniProt: G8X5B7
LinkDB All DBs
Position
797492..798766
Genome map
AA seq 424 aa AA seqDB search
MTFQNTLAFAQQLDIQDELKNYRSEFIFPQHNEKDVIYFTGNSLGLQPKRAKKYVDDIMN
DWASLAVEGHFYAEKPWWDYQERFAEPLSKIVGAKPSEVTVMNTLTVNLHLLMVSFYQPT
QKRYKIICEEKAFPSDQYMLQSQIKFHGFDPKEALVEIKRREGEHTIRLEDIIEKINELE
NELALVLWGGVNYYTGQVFDMQAITKAGHKVGAKVGFDLAHAAGNVELKLNEWNVDFAAW
CSYKYMNSGPGNASGCFVHEKHHHTNLPRFGGWWGHNKERRFKMEPDFDPILGADGWQVS
NLPVLSLAPYLASVQMFAEVGMEKLIKKRNQLTAYLEFILREIDQEISGTQFEIITPRNQ
EERACQLSVYLHGQGRTLFDYLMANGVITDWREPNVIRLAPVPFYCSYEDMYRFGEILIQ
FLKQ
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgacttttcaaaacacacttgccttcgcacaacaattagatatacaggatgaattaaaa
aactatcgttctgaatttatatttccacaacacaacgaaaaagatgtgatttactttaca
ggaaattcactaggcttacaacctaaaagagcaaaaaaatacgtagatgatataatgaac
gactgggctagtttagcagttgaagggcacttttatgcagaaaaaccttggtgggattat
caagaacgttttgcagaacccttaagcaaaatagtgggagcaaaacctagtgaagtaacc
gttatgaataccttaacagtaaacttgcatctgttaatggtgtctttttatcaacctact
caaaaacggtacaaaattatttgcgaagaaaaagcattcccttcagaccaatatatgctg
caaagccaaataaaatttcatggttttgatcctaaagaggccctagtagaaatcaaacgt
cgagaaggagaacatacaattcgattagaggatatcatagaaaaaataaatgaactagaa
aacgagttagcattagttttatggggaggggttaattactacacaggacaagtttttgat
atgcaagccatcacaaaagctgggcataaggtaggggctaaagtaggttttgatttagcc
catgccgctggaaatgtagaattaaaacttaacgaatggaatgtagattttgcagcttgg
tgttcttataaatatatgaattcaggaccaggaaatgcttctggatgttttgtacatgaa
aaacaccatcataccaatctgcctcgttttggaggttggtggggacacaataaagaaaga
agatttaaaatggaacccgattttgatcccattcttggagcagatggttggcaagtaagt
aatttgcctgtattgtcgttagcaccctatttagcttcagttcaaatgtttgccgaagtg
gggatggaaaaattaataaaaaaacgcaaccagttaacagcctatttagaatttatcctt
cgtgaaattgatcaagaaatatcaggaacccaatttgaaataattacgccaaggaatcaa
gaggaaagagcgtgtcaactgtctgtatatttacatgggcaagggagaactctttttgat
tatttaatggctaatggagtaattaccgattggcgcgaaccgaatgtaatccgtttagca
ccagtgcctttttattgctcttacgaagatatgtacagattcggtgaaattttaatccaa
tttttaaaacaatag

DBGET integrated database retrieval system