KEGG   Flavobacterium columnare: FCOL_13120Help
Entry
FCOL_13120        CDS       T01653                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
fco  Flavobacterium columnare
Pathway
fco00010  Glycolysis / Gluconeogenesis
fco00053  Ascorbate and aldarate metabolism
fco00071  Fatty acid degradation
fco00280  Valine, leucine and isoleucine degradation
fco00310  Lysine degradation
fco00330  Arginine and proline metabolism
fco00340  Histidine metabolism
fco00380  Tryptophan metabolism
fco00410  beta-Alanine metabolism
fco00561  Glycerolipid metabolism
fco00620  Pyruvate metabolism
fco00625  Chloroalkane and chloroalkene degradation
fco01100  Metabolic pathways
fco01110  Biosynthesis of secondary metabolites
fco01120  Microbial metabolism in diverse environments
fco01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FCOL_13120
   00053 Ascorbate and aldarate metabolism
    FCOL_13120
   00620 Pyruvate metabolism
    FCOL_13120
  09103 Lipid metabolism
   00071 Fatty acid degradation
    FCOL_13120
   00561 Glycerolipid metabolism
    FCOL_13120
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    FCOL_13120
   00310 Lysine degradation
    FCOL_13120
   00330 Arginine and proline metabolism
    FCOL_13120
   00340 Histidine metabolism
    FCOL_13120
   00380 Tryptophan metabolism
    FCOL_13120
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FCOL_13120
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    FCOL_13120
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    FCOL_13120
Enzymes [BR:fco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     FCOL_13120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AEW87419
UniProt: G8XBK4
LinkDB All DBs
Position
3066727..3068295
Genome map
AA seq 522 aa AA seqDB search
MSTITQSAVAQQFGIVEALEQLGVKEINLGTSTGSNWFANGEIIESYSPVDGQLIGKVQA
STKEDYEKVMEAATTAFKTFKMMPAPKRGEIVRQFGEKLRKYKEPLGKLVSYEMGKSYQE
GLGEVQEMIDICDFAVGLSRQLHGLTMHSERFGHRMYEQYHPLGVVGIISAFNFPVAVWS
WNTALAWICGDVCVWKPSEKTPLCSIACQNIIAEVLKENNLPEGISCIINGDYKVGELMT
HDKRVPLVSATGSTRMGKIVAQACAARLGNSLLELGGNNAIIVTPDADIKMTVIGAVFGA
VGTAGQRCTSTRRLIIHEDIYDKVKDAIVAAYGQLRIGNPLDQNNHVGPLIDTDAVEAYN
KALEKVVAEGGNVIVPGGVLTGEGYESGCYVKPAIAEAQNHFEIVQHETFAPVLYLLKYT
GDVMNAIEIQNGVAQGLSSAIMTNNLREAEAFLSHAGSDCGIANVNIGTSGAEIGGAFGG
EKETGGGRESGSDAWKVYMRRQTNTINYTTDLPLAQGIKFDL
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacaataacacaatcagcagtagctcaacaatttggaattgttgaagcgttagaa
caattaggcgtaaaagaaatcaatttaggaacatcaactggatctaattggtttgctaat
ggtgaaatcattgaatcatattcacctgtagatggtcaattaattggaaaagtacaagct
tctacaaaagaagattatgaaaaagtaatggaagcggctactaccgcgtttaaaactttt
aaaatgatgcccgctcctaaacgaggagaaattgttcgtcaatttggtgaaaaattaaga
aaatataaagaacctcttggtaaattagtttcttatgaaatgggtaaatcttatcaagaa
ggtttaggagaagtgcaagaaatgattgatatctgtgattttgcagtaggtctttcacgt
caattacatggtttaacaatgcactctgagcgttttggacacagaatgtatgaacaatac
catccactaggggtagtagggattatttcagcgtttaactttccagtagcggtttggtct
tggaatacagctttagcttggatttgtggagacgtatgtgtatggaagccatctgaaaaa
acgcctttatgttcaatagcttgccaaaatatcatcgctgaagttttaaaagaaaataat
ttaccagaaggtatttcttgtatcattaatggtgattataaagtgggtgaattaatgaca
catgataaaagagttcctttagtatctgctacaggttcaactcgtatggggaaaatagta
gctcaagcttgtgccgcacgtttaggaaattcattattagaattaggaggaaataacgca
attatcgttactccagatgcagatattaaaatgaccgtaatcggagctgtttttggagct
gtaggaacagcaggccaaagatgtacttctactcgtagattgattattcatgaggatatt
tatgataaggtaaaagatgccatcgtagcagcttatggtcagttaagaatagggaatcca
ttagatcaaaacaaccatgtagggccacttattgatacagatgctgttgaagcatataat
aaagccttagaaaaagtggtagcagaaggaggaaatgttatcgttcctggtggtgtatta
acaggcgaaggatacgaaagcggttgttatgtaaaaccagcaattgccgaagctcaaaat
catttcgaaattgttcaacacgaaacgttcgcgcctgtattgtatttattaaaatacacg
ggagacgtaatgaatgctattgaaattcaaaacggtgtagcgcaaggtttatcatcagct
attatgacaaataatttacgcgaagcagaagcgttcttatcacatgcaggttctgattgt
ggtattgctaacgtaaacatcggtacatcaggagcagaaattggtggtgcatttggtggt
gaaaaggaaacaggtggcggccgtgagtctggatctgatgcttggaaagtgtacatgaga
agacaaacaaatacaattaattatacaacagatttgcctttagcacaagggattaaattt
gatttgtaa

DBGET integrated database retrieval system