KEGG   Fragilariopsis cylindrus: FRACYDRAFT_140762
Entry
FRACYDRAFT_140762 CDS       T04784                                 

Gene name
dsCyc9b
Definition
(GenBank) cyclin-like protein
  KO
K04503  G1/S-specific cyclin-D1
Organism
fcy  Fragilariopsis cylindrus
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-ProteinID: OEU20847
JGI: 140762
UniProt: A0A1E7FRU9
LinkDB
Position
Unknown
AA seq 273 aa
EDVPDRISIMLIQEENEYACFDYLAANEDIRKKAAKPVDEDCRVKMAEWCYQVVDFCKFR
RETVGIGMSYLDRYLCSNKGKKALGDRKEYQLVAMTCLYIAIKLHEPLEMETSLLADLSR
GCYTEMEFANMEQLILEGIDWRVSGPTPLAFVLHFLTFLPNNIPSSVEEAIFDYARYQTE
IAIANHSFVKIKPSVIGMAALINSIEGMDTSLLPERVQERFIRTIIMYTSIDIEAVENTQ
ASLSNILFSLLDEDGTKKYDKLFDEDSDEEDVD
NT seq 819 nt   +upstreamnt  +downstreamnt
gaagatgtcccagatagaatatcaataatgcttatacaggaagaaaatgaatatgcttgc
tttgattatttagcagccaatgaggacattcgaaaaaaggcagccaagcctgtcgatgag
gattgtcgtgtgaagatggcagaatggtgttatcaggttgttgatttttgtaaatttcga
cgtgagactgttggtattggtatgtcctatctagaccgatatttatgttccaataaagga
aagaaggcattaggtgatcggaaggaataccagttggttgcgatgacatgcttatatatt
gcaatcaaattacacgaaccattagagatggaaacatcattattagccgatcttagtcga
ggatgttacactgaaatggaatttgctaatatggaacaattaattttggagggaattgat
tggagagtgagtggtccaacacccctagcttttgttttgcatttcttaacattcctacca
aataatattccatcatcggtagaagaagcaatattcgactacgcacggtatcagacagaa
atagcaattgccaatcattcctttgtcaagataaaaccatcagtgatagggatggctgcg
ttaataaattccattgagggaatggatacgagccttttaccagaacgcgtacaggaacgt
tttattagaactatcatcatgtacacaagtatagatatcgaggcggttgaaaatacacaa
gctagtttaagtaatatcctgtttagtttgttggatgaagacggaaccaaaaaatatgat
aaattatttgatgaagatagtgacgaagaagacgttgat

DBGET integrated database retrieval system