KEGG   Fragilariopsis cylindrus: FRACYDRAFT_173934Help
Entry
FRACYDRAFT_173934 CDS       T04784                                 

Gene name
SDH5
Definition
(GenBank) succinate dehydrogenase
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
fcy  Fragilariopsis cylindrus
Pathway
fcy00020  Citrate cycle (TCA cycle)
fcy00190  Oxidative phosphorylation
fcy01100  Metabolic pathways
fcy01110  Biosynthesis of secondary metabolites
fcy01130  Biosynthesis of antibiotics
fcy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fcy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FRACYDRAFT_173934 (SDH5)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    FRACYDRAFT_173934 (SDH5)
Enzymes [BR:fcy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     FRACYDRAFT_173934 (SDH5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 FAD_binding_3 GIDA DAO HI0933_like
Motif
Other DBs
NCBI-ProteinID: OEU09181
JGI: 173934
UniProt: A0A1E7ET85
LinkDB All DBs
Position
Unknown
AA seq 609 aa AA seqDB search
MKGDYTVVDHEYDAVVVGAGGSGLRAAMGLSEAGFKTACVTKLFPTRSHTVAAQGGINAA
LGNMSEDDWRWHMYDTVKGSDWLGDQDAIHYMCKEAPQAVIELESFGMPFSRTENGEIYQ
RAFGGQSLEYGKGGQAHRCCAAADRTGHAMLHTLYGRSLAFDTTYFIEYFCLDLLMSDDG
TECVGIICLNMEDGSIHRIRAKNTVLATGGYGRAFFSCTSAHTCTGDGNAMALRKGIANQ
DNEFVQFHPTGIYGAGCLMTEGCRGEGGILRNSEGERFMERYAPSAKDLASRDVVSRAMT
MEIREGRGVGPKKDHIYLHLDHLPADLLAERLPGISETAAIFAGVDVTKEPIPTLPTVHY
NMGGVPTNYEGQVLQTTHDPNAKTKDDAWISDNPVPGLFAAGEVASASVHGANRLGANSL
LDIVVFGRACALKIAEDNKPGDKIAAMKEDEGMESLTNLDELRYRAGTVPTAVIRSELQH
AMQEHAAVYRDEQSLKDGVIKVDNIVQKFNMDCSVTDKSLIWNTDLVETLELQNLVACAS
TTITGAENRKESRGAHAREDCPDRDDINWMKHTLAYFDGSKTHLEYRPVHSFTLDENECK
YVPPFARVY
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtgattatacggtcgtcgatcatgaatatgatgcagtagttgtcggtgctgga
ggaagtggactcagagcagcaatgggtttatcagaagctggatttaaaacagcatgtgtc
accaaattattccccacacgttcacatacagtagcagcacaaggtggtattaatgcagca
ttaggtaatatgagtgaagatgattggagatggcatatgtatgataccgtgaaaggtagt
gattggttaggagatcaagatgcgattcattatatgtgtaaggaagcaccccaagcggtg
attgaattagaaagtttcgggatgcctttttcacgaacggaaaatggtgaaatctatcaa
cgtgcctttggtggacaatcattagaatatggaaaaggtggacaagcacatcgttgttgt
gcggcagctgatcggaccggacatgcgatgttacatacgttatatggacgtagtttagct
tttgataccacgtactttattgaatatttttgtttagatttattaatgagtgatgatggt
accgaatgtgttggtattatttgtttaaatatggaagatggaagtattcacagaatccgt
gcgaagaataccgtcttagcaacgggtggttatggtcgtgccttctttagttgtacgtcc
gcacatacctgtaccggggatggtaatgccatggccttacgaaaaggtattgccaatcaa
gataatgaatttgtccaattccatcccactgggatttatggtgccggatgtttaatgacc
gaaggttgtcgtggtgaaggtggaatattacggaatagtgaaggagaacgatttatggaa
cggtatgcaccgtcggccaaagatttagccagtcgggatgtcgtctcacgtgcgatgaca
atggaaattcgggaaggacgtggtgtgggacctaaaaaagatcatatttatttacattta
gatcatttaccagctgatttattagcagaacggttaccgggtatctctgaaacagcagca
atctttgctggtgtggatgtgacgaaagaaccgataccaacattaccgaccgtccattat
aatatgggtggcgttcccacgaattatgagggtcaagtcttacaaaccacacatgatccc
aacgcgaaaacgaaagatgacgcatggatctctgataatccagtacccggattatttgca
gccggtgaagttgcttccgcctcggtccatggtgccaatcgattaggtgctaattcgctc
ctggatattgttgtatttggacgtgcgtgtgcgttaaaaattgcagaagataacaagcct
ggtgacaaaattgctgccatgaaagaagatgaaggaatggaatccttaacaaatctcgat
gaattacggtatcgagcagggactgtccccactgctgtgatacgttctgaattacaacat
gcgatgcaagaacatgctgccgtatatcgagatgaacaatcgttaaaggatggtgtgatt
aaagttgacaatatagtccaaaaatttaatatggattgttccgtcactgataaatcatta
atatggaatactgatttagtagaaacattagaattacaaaatctcgtggcatgtgcctca
accaccattactggtgctgaaaatcgaaaagaaagtcgtggggcacatgccagagaagat
tgtcctgacagagatgatatcaattggatgaaacataccttagcctattttgatggtagt
aaaacacatttagaatatcgtccagtacattcctttacattagatgaaaatgaatgtaag
tatgtaccaccatttgcacgtgtctattaa

DBGET integrated database retrieval system