KEGG   Fragilariopsis cylindrus: FRACYDRAFT_244491Help
Entry
FRACYDRAFT_244491 CDS       T04784                                 

Definition
(GenBank) amine oxidase catalytic domain-containing protein
  KO
K11182  diamine oxidase [EC:1.4.3.22]
Organism
fcy  Fragilariopsis cylindrus
Pathway
fcy00330  Arginine and proline metabolism
fcy00340  Histidine metabolism
fcy00380  Tryptophan metabolism
fcy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fcy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    FRACYDRAFT_244491
   00340 Histidine metabolism
    FRACYDRAFT_244491
   00380 Tryptophan metabolism
    FRACYDRAFT_244491
Enzymes [BR:fcy01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.22  diamine oxidase
     FRACYDRAFT_244491
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cu_amine_oxid Cu_amine_oxidN2
Motif
Other DBs
NCBI-ProteinID: OEU12233
JGI: 244491
UniProt: A0A1E7F306
LinkDB All DBs
Position
Unknown
AA seq 807 aa AA seqDB search
MNFSKRKHVILFVAVSSILFVSSASSSSSSSSTATTTTDRYKDDDVDHNGIRGSSDHRPR
QQRREQECGECQEEGAVSSAGTFNRRESIFDQLNSEEYESLVEYVTGDGTNIADSTMDDI
DSSSKAFNRNYIVFMQLFPPPKAEAIAYLDGDTNNPPDRYAIVTIHRGRERPRDVMQYKI
GPIKNGEVQTENAVVEKLLKDNELPWAQRGNYSHLKKYVDDQVFKQAYTLRKLFRAATGG
YCFGGDECNGDDNMKYIEYANLATTPEKRITNIHFILQVPNGEFGPSCLLPVPISFQIIE
NPDIDPSQWETTNFEYCYQGPYESAEALLDAITNGAVEPCAAIRSSNAEWTSTDPIQPVR
QDATIKEPISYHSSGKRYVIDKGRDGVGHRVSWLGWTFHIASDQMHGMVVRNLSFQGERL
AYELNFQEFFASYSGMGGAGQTVYFDSNWEIGSYSALELGLDCPEDATLLPIIQHKNGAK
AEVSHNLMCIFEQPTGEPMWRHELSKSNRVAGIPRTLLKIRVVSVMGNYNYIPTLSLMAD
GVMKLDVEMGGYLQAGYSVDATQDENQESPFFGTRLHNNMAGLLHDHIIGVKADLDIGGV
QNTLMAGKVRYGTYEEATGGRSTKPGSYSYNGVKYMDWTTIDTERGISAKDYDTIIIASD
TTNKWGSQRSYEIAFDHTIPSQVFPSDHPVAAATVWQYSNVAITRQKDSERYCSFPSNYQ
IGTAFPSFDLREFQQQGDDVISEDLVFWIMFGVQHYPKAEDIPVVSNFGSGFVLKPRNMY
DRAAFEDLPDNRDVKHPVCIAPSIFNN
NT seq 2424 nt NT seq  +upstreamnt  +downstreamnt
atgaacttttcgaaaagaaagcacgttatattatttgtcgctgtctcgtcgatattattt
gtatcatcagcttcttcttcttcttcttcttcttcaacggcgacgacgacaactgatcga
tacaaggatgatgatgttgatcacaatggtatccgtggtagtagcgatcatcgacctcga
caacaacggcgtgagcaggaatgcggggaatgtcaagaagaaggagctgtatcttcggca
ggtacattcaatagaagagaatcaatatttgatcaactcaattcagaagaatacgagtca
ctcgtcgaatacgtaactggcgatgggacaaacattgccgattcgacgatggatgacatt
gatagttccagtaaagcatttaatagaaattatattgtgtttatgcagttatttccacca
cctaaagcagaagcgattgcatacctcgatggagatacaaacaacccacctgatcggtat
gctatagttacgatacatcgtggtagagaacgtccaagagatgtaatgcagtataaaatt
ggtccaataaagaatggggaagttcaaacagaaaatgcagtcgttgaaaaattattaaaa
gacaatgaattaccatgggcccaacgagggaattatagtcacttaaaaaaatacgtcgac
gatcaagtcttcaaacaagcctatacgcttcgaaagttattccgtgctgcaactggaggg
tattgttttggtggagatgaatgcaatggagatgataatatgaagtatatagaatatgca
aatctagcaacaacacccgaaaaacgtattacgaatatccattttattttacaagttcca
aatggcgaatttggtccgtcttgtttattaccagtaccgattagtttccaaatcattgaa
aatcccgacatcgatccgagtcaatgggaaacaacaaatttcgaatattgttaccaaggc
ccctacgaatccgcagaagcattattagatgcaatcacaaacggtgctgtggagccatgt
gcagcaatccgttcatccaatgcagaatggacgtcgaccgatccaatacagccagtccgc
caagatgcgacaattaaggaacccatatcctatcattctagtggcaaacgttacgtaatt
gataaaggcagggatggagttggtcatagagtatcttggttaggttggacgtttcatatt
gcatccgatcaaatgcacggaatggttgttcgtaatctatcctttcagggtgaacggttg
gcatatgaattgaactttcaggagttttttgccagttattcggggatgggaggagcggga
caaactgtgtacttcgattcgaattgggagattgggagttattcagctctagaattagga
ctagattgtcccgaggatgcaaccttacttcctatcattcaacacaaaaacggagcgaag
gcagaagtttctcataatctaatgtgtatttttgaacaaccaacaggagaacccatgtgg
cgccatgaattatctaaatcaaaccgcgttgcaggtatacccagaaccttactaaagatt
cgagtagtgagtgtgatgggcaattataattacataccaacgttatcactcatggcggat
ggtgttatgaaattggacgtcgagatgggcgggtacctccaggcggggtacagtgttgat
gctactcaagacgaaaatcaagaatcacctttttttggtacaaggctacataataatatg
gccggcttactccatgatcatatcattggcgtaaaagctgatttggatattggtggagtg
cagaatactcttatggcaggaaaagtcaggtatggtacctatgaggaagcaacgggtggt
agatcaacgaagcctggttcatattcgtacaatggtgtgaaatatatggattggactacg
atcgatacagaacgaggtatttcagcaaaagattatgatactatcataatcgcatccgat
acaacgaacaaatggggatcacaacgatcatacgaaattgcattcgatcatacaatacct
agtcaagttttcccttccgatcatccagttgctgcagcaacggtctggcaatatagcaat
gttgctattacccgtcaaaaagattcagaacggtattgctcatttccgtccaattatcaa
atcggtacagcatttccaagtttcgatttacgtgaatttcaacaacaaggagatgacgtt
ataagtgaagatcttgtcttttggattatgttcggcgttcagcattatccaaaggctgaa
gacattccagtggtatctaatttcggtagtggatttgttttaaaaccacgaaatatgtac
gaccgtgcagccttcgaagatttaccagataatcgtgatgtcaaacatccggtttgtata
gcacccagtatcttcaacaactaa

DBGET integrated database retrieval system