KEGG   Fragilariopsis cylindrus: FRACYDRAFT_259575Help
Entry
FRACYDRAFT_259575 CDS       T04784                                 

Definition
(GenBank) hypothetical protein
Organism
fcy  Fragilariopsis cylindrus
SSDB OrthologParalogGFIT
Motif
Pfam: WW
Motif
Other DBs
NCBI-ProteinID: OEU20550
JGI: 259575
UniProt: A0A1E7FQV7
LinkDB All DBs
Position
Unknown
AA seq 793 aa AA seqDB search
MLKLNYAVVLGSVILVTTRFTYSIASGPSGYTASPSYGGYNQQVQQQQQQEQEQQNYPQQ
QQQDQWYSEASYQKEGTTPQEDPAAVTATAGEEDVVPPLPEGWTEHLDPNSGQFYYFNAA
DGTTSWDRPSLPEDVEQGSVVEGENKEEDPRLSSISAENSPKYDQFSGNNGNTNFNENST
PEKQQEQQPAHDDSTGGSNNAITETGPGEMIGSPSEAERWQPNQSPDLKQSEAEKSSGYP
KQQQEKNLESHRQTDYPMTTSGWGSSPSIQSDSTASLVDEGGRQPEQIKQHYQGQPAHIN
QQEQQAQPGGWGLPRKDEDSSSQSEPWGVTKSTEQSSPQEQSYLPKQQQQQQSPPQLIRE
TAPPVNNTSPDQSSSEGKWGIPKAAAITQPPPGSEQRQSWQQQPPQQHNTQGSYQPPGSD
QRPPPRPVHQGPPQQNRLPPQQQHQPTQPPYLQRQQQQQPPPGQYNPNVSPGPGQYNQQY
GGPNNYGRGYPPQQPPPSQQTSTGQVVSQGVDQGTTAVKEALSSTWKGLLGFGAKTREVA
GTAREQVVTGATSASQTLGAKSSTFWETAKNTVGSVFENSNDPPGSQPGYSLSGHPQQPP
QQGNNMPPPGYPGRPTGPGGRGPPPGYGRGPPPRNNAGPPQQPNRYGPPFGGSPPGPGGP
PGRQQPPPSPNNQSQQQIKPQGYPAGPAGMQPRRDPAYPQMQKGPGGQQRRPVQTQYGGP
AGSQPPNQQQQQQQQQIPPGSGQRRPPYPGPQSNRGLPGQQGQPQPQQQKQQVPPQQKPQ
PDPWYHPGLMGDQ
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaattaaattatgccgtagtgctgggatctgtaatattggtgaccacgcgattc
acatactctatcgcaagtggaccatcaggatacacagcatcgccatcgtacggtggatat
aatcaacaggtacagcagcaacaacaacaagaacaagaacaacaaaattatccacaacag
caacaacaggaccagtggtattcagaggcatcgtaccagaaagaaggcacaactccgcaa
gaggatcctgctgcagttacagctacagccggcgaagaagatgtcgtacctcctctcccc
gaaggatggactgagcatcttgatccgaattcgggtcagttttactactttaacgcagct
gacggtacaacctcgtgggatagaccatctcttcctgaagatgtagaacagggtagtgta
gtcgaaggcgagaacaaggaagaagatcctcgactgtcgtcgatctcagctgaaaattct
ccaaaatatgatcaatttagtggcaacaatgggaatactaattttaatgaaaattcaaca
ccggaaaagcaacaagaacaacaaccggcccatgatgattcgacaggggggagcaacaat
gccatcacagagacaggacctggtgaaatgataggttcgccgtcggaagccgaaaggtgg
caaccaaatcaaagtccagatttgaaacagtcagaagcggaaaaatccagtggatatcct
aaacaacaacaggagaaaaatttggaaagtcatagacaaactgactatccaatgaccacg
tctggatggggttcttcgccatctattcaatcagactctactgcctccttggtcgatgaa
ggagggcgtcagccggagcaaataaaacaacattatcaaggccaaccagcacacataaat
cagcaggagcagcaagcacaaccaggtgggtggggactaccacgaaaggatgaagattcc
tcgtctcagtcggaaccgtggggtgtaactaagtctactgaacaaagttcccctcaggag
caatcatatcttccaaaacagcagcagcagcagcagtcaccccctcaactaatccgagaa
acagcgccaccagttaataacacttctccggatcaaagttcaagtgaggggaaatgggga
attcctaaggctgccgcaatcactcaaccgccacctggaagtgagcaacggcaatcatgg
cagcagcagccgccgcagcaacataacacacagggcagttatcagccacccggttctgat
cagcgacctcctccgagaccggtacatcaaggtccccctcaacagaatagacttccaccg
cagcagcagcatcaaccaacgcaacccccgtacttacagaggcaacagcaacagcagccc
ccacctggccagtataatccaaatgtatcacctggacctggtcaatacaatcagcaatat
ggcgggccaaataactacggcaggggctatcctccgcagcaaccgcctccatctcagcag
actagcactggacaggttgtttcccagggagttgaccaaggaacgactgcagtcaaagaa
gccttgagttctacatggaaaggtcttcttggttttggagctaagactcgagaggtagct
ggtaccgctcgtgagcaagtagtcactggtgcaacatcagcaagccaaacactcggtgcc
aaaagttccaccttctgggaaacagcaaaaaatactgttgggagtgtcttcgaaaatagt
aatgaccctcctggttcccaaccgggctactcgctgtcaggtcaccctcaacaacctcct
caacagggcaataatatgcctcctccaggttatccaggaagaccgacaggacccggtgga
agaggtcctcctcctggttatggaagaggtcctcctccgagaaataacgcaggaccacca
caacaacctaatcgatacggacctccttttggtggatcgccgcctggacctggtggacca
cctggacggcagcaaccacctccctcaccgaataatcagtcacagcaacaaataaaacca
cagggttatcctgctggtcctgctggtatgcaaccaagaagagatcctgcatatcctcag
atgcagaaaggaccaggagggcaacaacgtcgtccagtgcaaacgcaatatggtggtcca
gcgggatcacaaccaccaaatcaacaacaacaacagcagcagcagcagattcctcctggt
tctggacagagacggccaccgtatccaggacctcagtccaataggggtcttccgggacaa
caaggtcaaccacaacctcaacaacaaaaacagcaagttccacctcaacaaaaaccacaa
ccagatccttggtatcatccgggtctaatgggtgaccaatga

DBGET integrated database retrieval system