KEGG   Flavivirga eckloniae: C1H87_10490Help
Entry
C1H87_10490       CDS       T05284                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
fek  Flavivirga eckloniae
Pathway
fek00620  Pyruvate metabolism
fek00680  Methane metabolism
fek01100  Metabolic pathways
fek01120  Microbial metabolism in diverse environments
fek01200  Carbon metabolism
Module
fek_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:fek00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    C1H87_10490
  09102 Energy metabolism
   00680 Methane metabolism
    C1H87_10490
Enzymes [BR:fek01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     C1H87_10490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 WSN
Motif
Other DBs
NCBI-ProteinID: AUP79102
UniProt: A0A2K9PPW6
LinkDB All DBs
Position
complement(2572048..2574636)
Genome map
AA seq 862 aa AA seqDB search
MSVEPKLKRFNQSVLSKYQIYNSIFMTLPFDSVTKTGVLLPLFHETCKKGFKNGDDPTAI
VETFFEKYQARRNKESQINLLFRFIQYIERQVVLFDAIEDAAYPIVNNMDGVGTLRNLKG
SATSEGKMDALKAFLEEFKVRIVLTAHPTQFYPGSVLGIITNLTEAIKENNLSQINNLFG
QLGKTPFFKREKPTPYNEAKSLIWYLENVFYKTFGEIYNYIQTNIYADGKKHNDIINLGF
WPGGDRDGNPFVKPETTLKVANKLKRSVLKKYYEDLKDLRRKLTFRGVEERVIKLETILY
KYSINLNYKKAITHKELIVELLSIRNEVVKEHQSLYVDELNQIINRVHLFGYWFATLDVR
QDSRIHHSVFTAVIDHLIETGDDSIPSNYHDLSEPEQIKLLSEISDKSIDISVFKDEMVY
NTLKTIEVIKDIQETNGERGANRYIISNNQTALNVIQLFTMLKLVAFKDDLTVDVVPLFE
TIDDLENAPGVMEQLYSNPAYMAHLKKRGNKQTIMLGFSDGTKDGGYLMANWGIYKAKEL
LTKMSRKYDITAIFFDGRGGPPARGGGKTHNFYSSLGPTIEDKEVQLTIQGQTVSSNFGT
LDSSQYNLEQLISSGIKNRIDHDKNRMSEEDRVVMNDLAETSYQTYKDFKSHPMFIPYLE
RMSTLKYYAKANIGSRPSKRSNSDKLVFSDLRAIPFVGSWSQLKQNVPGFFGVGTALKVY
EDNGEFDKVEQLYKNSKFFKTLLENSMMSLSKSFFDLTKYMSRDPEFGEFWNIIYAEYQT
TKRLLLKLTGYEQLMENEPSGKASIDVRESIVLPLLTIQQYALKKVQELEKAEVKDEEQL
KIFEKIVTRSLFGNINASRNSA
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtagagccaaaattaaagcgatttaatcaatcggttttgtcaaaatatcaaata
tacaacagtatattcatgacattaccttttgattctgtaactaaaaccggagtattactt
cctttatttcacgaaacctgtaaaaaaggttttaaaaatggtgatgatcccactgccatt
gttgaaacattttttgaaaaataccaggcacgtagaaacaaggaaagccaaataaactta
ttatttagatttatacaatacatcgaaaggcaagttgttttatttgacgctatcgaagat
gctgcttaccctattgtaaacaacatggatggtgttggtacattaagaaacttaaaagga
tctgcaacttctgaagggaaaatggatgcattaaaagcctttcttgaagagtttaaggtc
cgtattgttttaactgctcaccctacacaattttaccctggatctgttttagggattatt
acaaatttaaccgaagccattaaggaaaataacctttctcaaataaataatttatttggg
caattgggtaaaacgcctttctttaagcgcgaaaaacctacgccttacaatgaagcaaaa
agcttgatttggtatttagagaacgttttttacaaaacatttggcgaaatatacaactat
atccaaaccaatatttatgccgatggaaaaaagcataacgatattataaatcttggattc
tggcctggtggtgatagagatggtaatccttttgtaaaaccagaaaccactttaaaggtt
gccaataaacttaaacgatctgtccttaaaaaatattacgaagaccttaaggatttaaga
cgcaaacttacatttagaggtgttgaagaacgtgtaataaaacttgaaaccatactttat
aagtacagcatcaatctaaattataaaaaagccattacgcataaagagcttattgttgaa
ttattgagtataagaaacgaggttgttaaagaacatcaatcgctttatgttgatgaatta
aatcaaattataaacagagtacacctttttggatactggtttgcaactttggatgttaga
caagatagtagaattcaccattctgtttttacagcggtaatagatcatttaattgaaacg
ggggatgattctattccaagcaactaccatgatttatccgaacccgagcaaattaaatta
ttatctgaaatatcggataagtcaatagacattagtgtttttaaagatgaaatggtatat
aatactttaaaaactatcgaggttattaaagatattcaagaaaccaatggcgagcgtgga
gcaaacagatatattataagcaataaccaaacagccttaaatgttattcagcttttcacg
atgcttaaactggttgcatttaaagatgatttaacggtagacgttgtgcctctgtttgag
accatagacgatcttgaaaatgcgcctggtgttatggagcaattatatagcaacccggct
tatatggctcatcttaaaaagagaggcaacaagcaaacgattatgttaggattctctgat
ggtacaaaagatggtggttacttaatggcaaactggggtatttataaagctaaagagttg
cttaccaaaatgtctagaaaatacgacataaccgctatattctttgatggacgtggtgga
ccaccagcaagaggtggaggtaaaacacataacttctactcatcattaggtccaactatt
gaagacaaggaagtacagcttactattcaaggacaaaccgtaagttctaatttcggaact
ttagactcgtcgcaatacaacttggagcaattaataagttctggtattaaaaaccgaata
gaccacgataagaacagaatgtctgaagaagacagagttgttatgaacgatcttgcggaa
acaagctaccaaacttataaagattttaaaagccacccgatgttcatcccttacttggag
cgcatgagtactttaaaatattacgctaaggctaatattggtagtagaccttctaaacga
tctaactccgataagttggtgttttcagatttaagagcaataccatttgtaggatcatgg
agtcaattaaaacaaaatgttcctggtttctttggtgttggtacagccttaaaagtttac
gaagacaatggcgagttcgataaagtagaacagctttacaagaattcaaagttctttaaa
accttgctggaaaacagtatgatgtccttatcaaaatcattcttcgatttaactaaatat
atgtccagagatcctgaatttggtgagttttggaatattatttatgccgaataccaaaca
accaaaaggttactgttaaaactaaccggttatgagcaattaatggaaaacgaaccttct
ggaaaagcttctattgatgttagggaatcgattgttttaccattactgactattcagcag
tatgcacttaaaaaagttcaggaactggaaaaagcagaagtaaaagacgaagaacaacta
aaaattttcgagaagattgtaacacgctctctatttggtaacattaatgctagtagaaat
tcggcttag

DBGET integrated database retrieval system