KEGG   Flavivirga eckloniae: C1H87_12880Help
Entry
C1H87_12880       CDS       T05284                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
fek  Flavivirga eckloniae
Pathway
fek00240  Pyrimidine metabolism
fek01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fek00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    C1H87_12880
Enzymes [BR:fek01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     C1H87_12880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22
Motif
Other DBs
NCBI-ProteinID: AUP79554
UniProt: A0A2K9PR71
LinkDB All DBs
Position
complement(3119551..3120204)
Genome map
AA seq 217 aa AA seqDB search
MFLENTVNHKEQFGWIEVICGSMFSGKTEELIRRLKRAQFARQKVEIFKPAVDVRYDEEM
VVSHDANEIRSTPVPAAANIPILADGCDVIGIDEAQFFDDEIVRVCNDLANKGVRVIVAG
LDMDFKGNPFGPMPSLMATAEYVTKVHAVCTRTGNLAQYSYRKAKSDNLVLLGEVDEYEP
LSRAAYYKAMMRDKVRNMNVNEAEEVTPKPKDTDADA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttgaaaatacggtaaatcataaagaacaatttggatggattgaagttatttgt
ggctcgatgttctctggaaaaacagaagaattgatccgcaggcttaagcgcgcccaattt
gcaagacaaaaagtagagatttttaaaccagccgtagatgtacgttacgatgaagaaatg
gtagtctctcatgatgccaacgaaattcgatcaacccctgtccctgctgcagctaacatt
cctattttagcagatggttgtgatgttattggtattgatgaggctcagttttttgatgat
gaaattgtacgtgtttgtaacgatttagcaaacaaaggtgttcgggttattgttgccggg
ctcgatatggactttaaaggtaatccttttggccccatgccttctttaatggcaacagca
gaatatgttacaaaagtacatgcagtttgcaccagaactggtaatttggcacaatatagc
tatcgcaaagctaaaagcgacaatctggtacttcttggcgaagtagatgaatacgagcct
ttaagcagggcggcttattacaaagccatgatgcgtgataaagttagaaatatgaatgta
aatgaagccgaagaagtgacacctaaacctaaagacacggatgcagatgcctaa

DBGET integrated database retrieval system