KEGG   Flavivirga eckloniae: C1H87_18190Help
Entry
C1H87_18190       CDS       T05284                                 

Definition
(GenBank) glycoside hydrolase family 2
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
fek  Flavivirga eckloniae
Pathway
fek00052  Galactose metabolism
fek00511  Other glycan degradation
fek00600  Sphingolipid metabolism
fek01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fek00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    C1H87_18190
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    C1H87_18190
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    C1H87_18190
Enzymes [BR:fek01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     C1H87_18190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro2_C5 Glyco_hydro_2_C DUF4982 Glyco_hydro_2_N Glyco_hydro_2 BetaGal_dom4_5 Invasin_D3 Big_1 DUF4506 DUF4397
Motif
Other DBs
NCBI-ProteinID: AUP81678
UniProt: A0A2K9PXX0
LinkDB All DBs
Position
4391475..4393964
Genome map
AA seq 829 aa AA seqDB search
MKIIKWVCSIVLLVTITSILSCKETSKRSASIEDQNFNKGWLFKKDTIVGAEAINFKDTE
WRKLDLPHDWAIEGPFSNVNNARTGGLPIDGEVWYRKHFNLDRSYSNKQVSIEFDGAMAN
AKVWLNGEYVGERPYGYIGFELDLTPYAKFGEENVIAVKLVTKHLSARWYPGAGIYRNVR
LKINDAIHIPQYGTYITTPNVSKERAEVSIETKIKNRSSSHSEAILNTIIKNDKGMVVSE
TKTNVSIEKESEAVANVSLNVENPKLWDIINPVLYEATSTVIVEGTIVDRYITSFGIRTI
EFDREKGFLLNGNAVKLNGVCMHHDQGPLGSAINFRAKQRQMQIMQSMGVNALRTSHNPP
SPEILKACDELGIVVIVEAFDEWKIGKVENGYNKHFDEWHEIDLRDMIKRDRNHPSVIMW
SIGNEILEQSQKDGWKITKRLNDICHDEDNTRPTTVGFNYFPAPFENKLAEYVDVVGMNY
WPENYKEILDNNPEMIVYGSETSSMTSSRGVYHLPIEYTEKHETNHVTSYDAIVGPPWAY
LPDAEFDALAKEPRSLGEFIWTGFDYLGEPTPYGGRDNSTNGYWNDDWPSRSSYFGPVDL
CGFPKDRYYLYQSQWTTKPMVHVLPHWNWEGKEGEKIPVFAYTNAEEVELFVNGKSYGKK
VKGKDITEIPAEYHEFEKGMYKSKYRLSWQVPYQPGALKVVAFKGGKEVATKEIKTAGAP
AKVTLIADRTEIDADGNDLSFITVRIEDKDGNICPLADNLVNFDIQGAGVLAAVGNGDQT
SLASFQATNRKAFNGLCMFIVKSTETAGEIKITASSKELASETITVSTN
NT seq 2490 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattataaaatgggtttgttctatagttttattagtaacaataacctcaattctt
tcgtgtaaagaaacttcaaaaagatctgcttcaatagaagatcaaaactttaataaaggt
tggctgtttaaaaaggataccattgtaggagccgaagctattaactttaaagatacagaa
tggcgaaaattagatttgccgcacgattgggccatcgaaggtccttttagcaatgttaat
aacgcaagaacaggagggttgcctatagacggagaggtttggtacagaaaacattttaat
ttagatcgttcttattcaaacaaacaggtgtctattgagtttgatggtgccatggccaat
gctaaagtttggttaaatggcgagtatgttggagaaagaccatatggttatattggtttt
gaactagacttaacaccttatgctaagtttggcgaagaaaatgtcattgcagtaaaactt
gttactaaacatttatcggcacgttggtatccaggagctggaatttatagaaatgttcga
ttaaagattaatgatgcgattcatattccgcaatacggaacttacataacaacaccaaat
gtttccaaagagcgcgcagaagtatccatagaaactaaaattaaaaacaggagttcaagt
cattcagaagctatacttaatacaattataaagaatgataaagggatggtagtttcagaa
accaaaacgaatgtttcaattgaaaaagaatctgaagcagtagccaatgtctctttaaat
gtagaaaatccgaagctatgggatattataaatccggtactttatgaagctactagtacc
gtaattgtagaaggtaccattgtagatcgatatataaccagttttggaattagaaccatt
gaatttgatagagaaaaagggtttctgctaaatggaaatgcagtaaaactaaatggtgtt
tgcatgcaccatgaccaaggccctttggggagtgcaattaattttagagcaaaacaacgc
cagatgcagattatgcagagtatgggggtaaatgcattgagaacaagtcataacccacct
tccccagaaatattgaaagcttgtgatgaattgggtattgttgttattgttgaagctttt
gatgaatggaaaataggaaaagtagaaaatggttacaataagcattttgatgaatggcat
gaaatagatttacgagatatgattaagcgggatcgtaaccacccgtctgttattatgtgg
agcattggtaatgagattttagaacagtcgcaaaaagacggatggaaaattactaaacgt
ttaaatgatatttgccacgatgaagataatacgagacccactactgtagggtttaattat
tttcctgctccttttgaaaacaaattagcagagtatgtagatgtagtagggatgaactac
tggccagaaaactataaagaaattttagataataacccggaaatgattgtttatgggtcg
gaaacatcttcaatgaccagtagtcgtggtgtttaccatttaccaattgaatacaccgaa
aagcatgaaaccaatcacgttaccagttacgatgccatagtaggtccgccttgggcttat
ttgccagatgcagagtttgatgcattggctaaagagccaaggtctttaggagaatttata
tggacaggtttcgattatctgggagaaccaacaccttatggtggtcgggataattcaaca
aatgggtattggaatgatgattggccatcgcgctcatcgtattttggacccgttgattta
tgcggattccctaaagatagatactatttataccaaagtcagtggacaacaaaacctatg
gtacatgtgttgccacattggaattgggaaggtaaagagggcgaaaaaatacctgtattt
gcttataccaatgcagaagaagtagaattatttgtaaatggtaaatcttatggtaaaaaa
gtaaaaggaaaagatattactgaaattccagcagagtatcatgagtttgaaaaaggtatg
tataaatctaagtatcgtctttcttggcaagtaccataccaaccaggagcattaaaggta
gtagcctttaaaggtggaaaagaagtcgctaccaaagaaataaaaactgctggcgctcca
gcaaaagtgacattaatagccgatagaactgaaattgatgcagacggtaatgatttatct
tttataacggttaggatcgaagataaagatgggaatatttgccctcttgcagacaattta
gtgaatttcgatattcaaggagcaggtgttttagcagctgttggtaatggggaccaaaca
tcgttagcatcttttcaagcaactaacagaaaagcatttaatgggctatgtatgtttatt
gtaaaatctactgaaacagctggggaaataaaaattacagcttcctctaaagagctagct
tcagaaactattacggttagcacgaattaa

DBGET integrated database retrieval system