KEGG   Flavivirga eckloniae: C1H87_19815Help
Entry
C1H87_19815       CDS       T05284                                 

Gene name
cobC
Definition
(GenBank) alpha-ribazole phosphatase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
fek  Flavivirga eckloniae
Pathway
fek00860  Porphyrin and chlorophyll metabolism
fek01100  Metabolic pathways
Module
fek_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:fek00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    C1H87_19815 (cobC)
Enzymes [BR:fek01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     C1H87_19815 (cobC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AUP80835
UniProt: A0A2K9PUT1
LinkDB All DBs
Position
complement(4837716..4838285)
Genome map
AA seq 189 aa AA seqDB search
MEVYLIRHTTPDIKKGICYGQSDLNLADTFSKEFKAIEEQIPNNKSYSIKSSPLKRCALL
AEHLGNPVLFDDRLKEFDFGNWEMKSWDNIPKDELNLWMKDFVNFKVPNGESYTDLASRV
LNFFEDIINSNSEQDLIIVTHAGPMRAFLASILNIPLEKSFDIKIQYGDVFHLKKDGNSW
KLLSEIALE
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggaagtatatctaataagacatacaacacctgacataaaaaaaggaatatgttacggt
caatccgatttaaacttagcagacactttctctaaagagtttaaagcaatagaagaacaa
attcctaacaataaaagttacagcataaaaagtagtccattaaaacggtgtgctttactg
gccgaacacctgggaaatcctgttctttttgacgatcgcttaaaagagttcgattttgga
aactgggaaatgaaatcttgggacaatatcccaaaagatgaattaaatctatggatgaaa
gatttcgtcaactttaaagttccaaatggagaatcttataccgatttagcttccagagta
ctaaatttctttgaagacatcataaattcaaatagcgaacaagatcttataatcgttaca
cacgcgggaccaatgagagcttttctggcatccattttaaatataccgttagaaaaatcg
tttgatattaaaattcaatatggagatgtttttcatcttaaaaaagatgggaattcttgg
aagcttctttctgaaatagcgttagagtaa

DBGET integrated database retrieval system