KEGG   Ferrovibrio sp. K5: FNB15_03660Help
Entry
FNB15_03660       CDS       T06089                                 

Definition
(GenBank) cystathionine gamma-synthase family protein
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
fer  Ferrovibrio sp. K5
Pathway
fer00270  Cysteine and methionine metabolism
fer00450  Selenocompound metabolism
fer01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fer00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    FNB15_03660
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    FNB15_03660
Enzymes [BR:fer01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     FNB15_03660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Met_gamma_lyase Aminotran_1_2 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: QDO96424
UniProt: A0A516GY07
LinkDB All DBs
Position
782998..784290
Genome map
AA seq 430 aa AA seqDB search
MAKRTETKTRSGDRDLHPETQMMSYGYNPFLSEGAVKPPVFLTSTFAYRTAEDGAAFFDL
MAGRTKLPPGEKAGLIYSRFNHPNLEIVEDRLALLEGAEAAAVFSSGMAAIASAFLTFLR
PGDTLLHSSPLYGGTETMIRKVLPEFGISTAEFHDGLHDRDITAAAASAKGRIAMIFIET
PANPNNAMVDFAMVAKTADAIAKKQDGQRPLIVCDNTMLGPIFQKPLRHGVDIAVYSLTK
YVGGHSDLVAGSAVGAKQHLDRIRSYRNTFGSQLDPHSSWMIARSLETLVIRMTRAAESG
RKVAQWLNTNPHMPVEVHHPEFITDNTYQEVYARQCSGPGSTFAFTLKGATRQQAFRVIN
ALQLFKSAVSLGGTESLMCHPASTTHSGVGKAILDQLGVTEGLIRVSIGLEHPDDLIDDL
DGAFKEALGT
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggccaaacgcaccgagaccaagacccgcagcggcgaccgcgacctgcatcccgaaacg
cagatgatgagttacggctacaatcccttcctgtcggaaggcgccgtgaagccgccggtc
ttcctcacctccaccttcgcctacaggacggcggaagacggcgccgccttcttcgacctg
atggcgggccgcaccaagctgccgccgggcgaaaaggccggactgatctacagccgcttc
aaccaccccaatctcgagatcgtcgaggaccgtctggcgctgctcgaaggcgccgaggcg
gcggccgtcttttccagcggcatggcggcgatcgccagcgccttcctcacattcctgcgc
cccggcgacaccctgctgcattcctcgccgctctatggcggcaccgagacgatgatccgc
aaggtgctgcccgaattcggcatctcgacggccgaattccacgacggcctgcatgaccgc
gacatcacggcggcagcggcctcggccaagggccgcattgccatgatattcatcgagacg
ccggccaacccgaacaacgccatggtcgacttcgccatggtggccaagaccgccgacgcc
atcgccaagaaacaggacggccagcgcccgctgatcgtctgcgacaacaccatgctcggg
ccgatcttccagaagcccttgcggcatggcgtcgatatcgcggtgtattcgctgaccaaa
tatgtcggcggccacagcgacctggtcgccggcagcgcggtcggcgcgaaacagcatctc
gaccgcatccgcagttaccgcaacaccttcggcagccagctcgacccgcattcgagctgg
atgatcgcccgctcgctggagacgctggtgatccgcatgacccgcgccgccgagtccggc
cgcaaggtggcgcagtggctcaacaccaacccgcatatgccggtcgaggtgcatcatccc
gaattcatcaccgacaacacctaccaggaggtctatgcccgccagtgcagcggcccgggc
tcgacctttgccttcaccctgaaaggcgcgacacggcaacaggccttccgcgtgatcaac
gcgctgcagctgttcaagtcggccgtcagcctcggcggcacggaatcgctgatgtgccac
ccggcctcgacgacgcattcgggcgtcggcaaggcgattctggatcagctcggcgtcacc
gaaggcctgatccgcgtctcgatcgggctggaacatcccgacgacctgatcgacgacctc
gacggcgcgttcaaagaggcgctggggacgtaa

DBGET integrated database retrieval system