KEGG   Ferrovibrio sp. K5: FNB15_07630Help
Entry
FNB15_07630       CDS       T06089                                 

Definition
(GenBank) SDR family oxidoreductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
fer  Ferrovibrio sp. K5
Pathway
fer00061  Fatty acid biosynthesis
fer00780  Biotin metabolism
fer01100  Metabolic pathways
fer01130  Biosynthesis of antibiotics
fer01212  Fatty acid metabolism
Module
fer_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:fer00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    FNB15_07630
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    FNB15_07630
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    FNB15_07630
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:fer01004]
    FNB15_07630
Enzymes [BR:fer01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     FNB15_07630
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     FNB15_07630
Lipid biosynthesis proteins [BR:fer01004]
 Fatty acid synthase
  Component type
   FNB15_07630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: QDO99676
LinkDB All DBs
Position
complement(1565469..1566263)
Genome map
AA seq 264 aa AA seqDB search
MSGKRGLIMGVANDHSIAWGIASMLHQHGAELAFTYQGEAFERRVRPLAESVNAKAVVPC
DVEDEASMRNTFDTVAKAFGGQIDFVVHAIAYSDKEELKGRYLNTTRGNFSRSMLISCYS
FTEVARLAQPYMAQGGSLITLTYEGSTRVMPNYNVMGVAKAALEASVRYLAVDLGPQKIR
VNAVSPGPMRTLAGSAIGSARATFKFTAQHSPLRRNASLEEVGGAALFLLSDLGAGVTGE
IIHVDSGFHTIGIPNPADLNGSDA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcaagcgcggcctcatcatgggagttgccaacgaccactcgatcgcatggggc
atcgcctcgatgctgcaccagcatggcgccgagctggccttcacttaccagggcgaggcc
ttcgaacgccgcgtccgcccgctggccgagagcgtgaatgcaaaagccgtggtgccctgc
gatgtcgaggacgaagcctcgatgcgcaacaccttcgacacggtggccaaggcgtttggt
ggccagatcgatttcgtggtgcatgccatcgcctattccgacaaggaagagctgaagggt
cgctacctcaacaccacgcgcggcaacttcagccgctcgatgctgatcagctgctattcc
ttcaccgaagtggcgcgcctggcgcagccctatatggcgcagggcggctcgctgatcacg
ctgacctatgaaggcagcacgcgcgtgatgccgaactacaacgtgatgggtgtggccaag
gctgcactcgaagcgagcgtgcggtatctcgccgtcgatctgggtccgcagaagatccgc
gtcaatgccgtgtcgcccggcccgatgcgcacactggccggctcggccatcggctcggcc
cgcgccaccttcaagttcaccgcccagcacagcccgctgcgccgcaatgcctcgcttgag
gaagtcggcggcgccgcactgttcctgctgtccgatctcggcgccggcgtcaccggcgag
atcatccatgtcgacagcggcttccacacaatcggcattcccaatccggccgacctgaac
ggcagcgacgcataa

DBGET integrated database retrieval system