KEGG   Ferrimonas sp. S7: HER31_01085Help
Entry
HER31_01085       CDS       T06529                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
fes  Ferrimonas sp. S7
Brite
KEGG Orthology (KO) [BR:fes00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HER31_01085 (ahpF)
Enzymes [BR:fes01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     HER31_01085 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored HI0933_like DAO Thi4 NAD_binding_8 FAD_binding_3 Glutaredoxin AlaDh_PNT_C Thioredoxin_9 Thioredoxin_4
Motif
Other DBs
NCBI-ProteinID: QIZ75614
LinkDB All DBs
Position
230065..231657
Genome map
AA seq 530 aa AA seqDB search
MLDQAMKQQLKTYLGNVKNSVVLRLCLDDSDTATKLESLASDIASLSSHIEVVRDNDASQ
RQPMMLVENPDKGTSIGFAGLPMGHEFTSLVLALLHSGGHPIKLDEDTIAQIAELNVPLE
VEIFISLSCQNCPEVVQAFNMMAAINPLVKTTMIDGAAFQGEVKARDIMAVPSVFINGEL
FGQGRMSLAEILNKVDTGAAKRKAAQLNQQAPFDVLVVGGGPAGSSAAIYAARKGIRTGV
VAERFGGQVQDTMAIENFISIKATTGPKLVASLEEHVKEYGVEVITEQRAANIIGAEETA
DGYIHVELESGAVLKSRSVITSTGARWREMNVLGEQEYRNKGVAYCPHCDGPLFKGKRTA
VIGGGNSGIEAALDLAGIVEHVTVLEFADTLRADKVLIDKAQATANIDIITMAQTTEVLG
DGNRVTALEYKDRNSGEVKQIELAGIFVQIGLVPNSEWLKESKVALSGRGEIEIDGHGAT
SLSGVFAAGDVTTVPYKQIIIAMGEGAKASLGAFDYLIRTPAPTEQSAAA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttagatcaagccatgaagcagcaacttaaaacctacctcggcaacgtaaaaaacagt
gtagttttgcgtttgtgtcttgatgacagcgacactgcaactaagctggagtcgttagct
agcgatatcgcttcgttgagcagccatattgaggttgtgcgcgacaatgatgccagtcag
cgccaaccgatgatgttggttgagaacccagataagggcacctcaattggctttgctggg
ctgccgatgggacacgaatttacctcgctggtgctggcactgctccacagtggcggtcat
cccattaagttggatgaggacactattgcccagattgctgagcttaatgtgccattagag
gtggagatctttatctcactctcctgtcagaactgtccagaggtcgtacaggcattcaat
atgatggcggcaattaatccattggtgaaaaccactatgattgacggtgccgctttccaa
ggtgaagtcaaagcgcgcgatatcatggcagtaccaagcgtattcattaacggggagttg
ttcggccaaggacggatgtcattagcggagatcctcaataaagtcgacaccggcgccgct
aagaggaaagccgctcagttgaatcaacaagcgccatttgacgtgttagtggttggtggt
ggtcctgctggttcttctgctgctatctacgccgcgcgtaaaggcattcgtaccggggtg
gtggccgagcgctttggtggtcaggtgcaagataccatggccattgagaactttatctca
ataaaagccactaccggaccgaagctggtggcaagcctagaagagcacgttaaagagtac
ggtgttgaagtgattaccgaacaacgcgccgctaacattatcggcgcagaagagactgcc
gatggttacattcacgtcgagttagaaagcggtgcagtcctaaaatcccgcagtgtgatc
accagtactggggcacgctggcgcgagatgaatgtactgggtgaacaggagtatcgtaac
aagggggtggcttactgcccgcactgcgatggtccactatttaaaggcaagcgaactgcc
gtaattggtggcggtaactctggcattgaagcggctctcgacttagctggtatcgttgag
cacgtcaccgtcttggagtttgcagataccttgcgtgccgacaaagtacttatcgacaaa
gcgcaggctacagccaacatcgacattatcaccatggctcaaaccacagaagtgctgggc
gatggcaaccgcgttaccgctcttgagtataaggatcgcaacagcggcgaggttaagcag
attgagttggcagggatttttgtgcaaattggcttggtgccaaacagtgagtggttgaag
gagtcaaaggtcgccctgtctggccgtggtgagattgagattgatggccacggtgctaca
agtttaagcggagtttttgccgccggggacgttaccacagtgccgtacaagcagattatt
atcgctatgggtgaaggcgccaaagccagcttaggagcctttgattacctaatccgtact
ccggcgccaacagagcaatctgcagcagcgtag

DBGET integrated database retrieval system