KEGG   Flavobacterium faecale: FFWV33_00735Help
Entry
FFWV33_00735      CDS       T05515                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ffa  Flavobacterium faecale
Pathway
ffa00564  Glycerophospholipid metabolism
ffa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ffa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    FFWV33_00735
Enzymes [BR:ffa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     FFWV33_00735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA Pyr_redox_2 FAD_binding_3 HI0933_like Thi4 Pyr_redox_3 NAD_binding_8 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AWG20148
UniProt: A0A2S1L8Y4
LinkDB All DBs
Position
157998..159581
Genome map
AA seq 527 aa AA seqDB search
MKHTEQLSKLKQTPEWDVIIIGGGASGLGTALDAASRGYKTVLVEAVDFAKGTSSRSTKL
VHGGVRYLEQGDVSLVREALKERGLMAQNANHLVKNQSFVIPNYNWWGGYFYTIGLTIYD
MLAGKLSLGKSQYISKKKTIELLPTVEQKGLVSGVIYQDGQFDDSRLAINIAQTAVENGA
TLVNYTKVINLIKDDNNQVIGVKVENQETGEVYDLKGKAIINATGVFTNAIMKMNDKVYK
KYIVPSQGIHLVFDKSFLPSDHALMIPKTSDGRVLFAVPWHDKIVVGTTDTLIKSHSLEP
IALEKEIEFVLETAQRFLAKKPTRADVLSVFAGLRPLAAPEKEGKSTKEVSRSHKIFVSE
TGLITITGGKWTTYRKIAEDIINKAIATKKLPMKECKTEHISIHGNLPTNTKDRENHLYI
YGTDIPKIIALQKQEPALVEKLHPKYDYTLAEVVWAIRHEMARTIDDVLSRRVRLLFLDA
RAAMEVAPKVAHLIAKELGHDQAWIDNQITEFNTLANGYLLTEFKTI
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatacagaacaattatcaaaactaaaacaaacccctgaatgggatgttattatt
attggtggtggcgctagcgggctaggtactgctcttgacgcagccagcagaggctacaaa
accgtattggttgaagctgtagattttgcaaaaggaacctcaagcagaagtaccaaacta
gttcacggaggcgtacgctaccttgagcaaggagatgtttcacttgtaagagaagcattg
aaagaaagaggattaatggctcaaaacgccaatcaccttgtgaaaaatcaatccttcgtt
atcccaaattacaattggtggggaggttacttctacacgatcggacttacgatttatgat
atgttggctggtaaacttagcctaggaaaatcgcaatacatttcgaaaaagaaaactatt
gaactacttccaacagtagagcaaaaaggactcgtaagcggtgtaatttatcaagacggt
caatttgacgactctagattagcgatcaatattgctcaaactgcagttgaaaatggcgct
acccttgtaaactacacaaaagttatcaatttaataaaagatgacaacaatcaagtaatt
ggagttaaggttgaaaatcaagaaactggtgaggtatatgatttaaaaggaaaagccatc
atcaatgcaacaggtgtctttaccaatgctatcatgaaaatgaatgataaagtatataaa
aaatacatcgttccaagtcaaggaattcaccttgtatttgataaatcatttttacctagt
gatcacgccttaatgattccgaaaacaagtgatggccgtgtcctgtttgctgtgccttgg
catgataaaattgtggttggaactactgacactttgataaaaagtcatagtttagaacca
attgcattagaaaaagaaatcgaatttgtacttgaaactgctcaacgtttcctagcaaaa
aaaccaactcgtgccgatgtgctttctgtatttgctggattacgaccgcttgcagcccca
gaaaaagaaggaaaaagtactaaagaggtttcgagaagccataagatatttgtttctgaa
acaggacttatcaccatcactggaggaaaatggacgacttatagaaaaattgccgaagat
atcatcaacaaagctattgctaccaaaaagttacctatgaaagaatgtaaaacagaacac
atttcgatccacggtaacctaccaacaaacactaaagacagagagaatcacctgtacata
tacgggactgatattcctaaaatcattgcgctacaaaaacaagagcctgcactagttgaa
aaactacatccaaaatacgactacacattggcagaagtagtttgggcgatacgccatgaa
atggcacgaactattgatgatgttctttcaagaagagtaagactcttattcttggatgct
agagccgcaatggaagttgcaccaaaagtagcccatttaatcgcgaaggaacttggacat
gatcaagcctggattgataatcagattacagaatttaatacccttgcaaacggctaccta
ttaacagaatttaaaacaatctaa

DBGET integrated database retrieval system