KEGG   Flavobacterium faecale: FFWV33_05900Help
Entry
FFWV33_05900      CDS       T05515                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ffa  Flavobacterium faecale
Pathway
ffa00240  Pyrimidine metabolism
ffa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ffa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    FFWV33_05900
Enzymes [BR:ffa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     FFWV33_05900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22
Motif
Other DBs
NCBI-ProteinID: AWG21099
UniProt: A0A2S1LBH7
LinkDB All DBs
Position
1343357..1343947
Genome map
AA seq 196 aa AA seqDB search
MFLENTVNHKEQFGWIEVISGSMFSGKTEELIRRLKRAQFAKQKVEIFKPSIDTRYHDEL
VVSHDANEIRSTPVPAAANISILAQGCDVIGIDEAQFFDDEIVTVCNNLANQGIRVIVAG
LDMDFKGNPFGPMPALMATAEYVTKVHAVCTRTGNLANYSFRKNDSEKLVMLGETEEYEP
LSRAAYYRATHKSQDE
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcgaaaatacagtaaatcataaagagcagtttgggtggattgaagtgatcagt
gggtcgatgttttcaggtaaaacagaagagttgattcgccgattgaaaagagctcaattt
gccaaacaaaaagtcgaaatttttaaaccttctatagatacaagataccatgatgaacta
gttgtttctcatgatgccaacgaaatacgatcaactccagtgcctgcagcagccaatatc
tctattttagcacaaggttgtgatgtgatcggaattgacgaagctcaattttttgatgac
gaaatagtgactgtttgtaacaatcttgccaatcaaggtattcgtgtcatcgtagccgga
ttggacatggattttaaaggaaacccttttggtcctatgcctgcactcatggctacagcc
gagtatgtcaccaaggtgcatgcggtatgtacacgcacagggaatttagccaattatagt
tttcgaaaaaatgatagcgaaaaactagtaatgctaggagaaaccgaagaatacgaaccc
cttagtcgggcagcatattatagagcaacacacaaaagccaagacgaataa

DBGET integrated database retrieval system