KEGG   Flavobacterium faecale: FFWV33_11420Help
Entry
FFWV33_11420      CDS       T05515                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ffa  Flavobacterium faecale
Pathway
ffa00473  D-Alanine metabolism
ffa00550  Peptidoglycan biosynthesis
ffa01100  Metabolic pathways
ffa01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ffa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    FFWV33_11420
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    FFWV33_11420
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    FFWV33_11420
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ffa01011]
    FFWV33_11420
Enzymes [BR:ffa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     FFWV33_11420
Peptidoglycan biosynthesis and degradation proteins [BR:ffa01011]
 Precursor biosynthesis
  Amino acid ligase
   FFWV33_11420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp ATP-grasp_4 CPSase_L_D2 GARS_A
Motif
Other DBs
NCBI-ProteinID: AWG22076
UniProt: A0A2S1LEW2
LinkDB All DBs
Position
complement(2650499..2651470)
Genome map
AA seq 323 aa AA seqDB search
MKNIAIIMGGYSSEYKISLISGNVVYQNLDYKKYNPFCVHIFKDKWVYVDADDREYPIDK
NDFSSTVDGKKITFDCVFNAIHGTPGEDGLMQAYFELIGMPQTACDYYQAALTFNKRDLL
SVLKPYGIQTAISYYLNLGDEINIDEIISKVGLPCFVKPNKAGSSFGISKVHALEDLPTA
IETAYKEDNEIIIESFLDGTEVSVGVINYKGKVTVLPMTEIVSENDFFDYEAKYLGKSQE
ITPARISDELTEKVGAIAKRAYEVLKMKGFSRSEFIIVNDEPFMLEMNTIPGMTNESLLP
QQAAAAGISLQDLFGNAIEIALQ
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacattgccatcatcatgggcggttattctagcgaatacaaaatctcacttata
agcggaaacgtagtctaccaaaacttagattataaaaaatacaaccctttctgcgttcat
atatttaaagacaaatgggtctatgtcgatgcagatgatagagaatacccaatagacaaa
aacgatttttcgagcactgtagacggaaaaaaaatcacttttgactgcgtattcaatgcc
atccatggtacgccgggtgaagacggattgatgcaagcctactttgagttaatcggcatg
ccacaaacggcttgcgattattaccaagcagcactgacattcaataaaagggatttatta
tctgttttaaaaccttacggaatacaaacagcgatttcttactacctgaacttgggtgac
gaaatcaatattgacgaaattatctcaaaagtgggtttaccttgttttgtaaaaccaaac
aaagcaggttctagcttcggaatttcaaaagtacatgcccttgaagatttgcctactgca
attgaaaccgcatacaaagaagataacgaaatcattatcgaaagtttccttgacggaacc
gaagtttctgtgggcgttatcaactataaaggaaaagtaactgttttaccaatgaccgaa
atcgtttctgaaaatgatttctttgattacgaagccaaatatttagggaaatcacaagaa
attacacctgcgagaatttcagatgaattgaccgaaaaagttggagccatagccaagcgc
gcctacgaagtcttaaaaatgaaaggtttctctcgttctgaatttatcatcgtaaacgac
gaacccttcatgctcgaaatgaacacaattccgggaatgaccaacgaaagtttactgcca
cagcaagctgcagcagcaggtatctcattacaagatttgttcggaaatgcgattgaaatt
gctttacagtaa

DBGET integrated database retrieval system