KEGG   Flavobacterium faecale: FFWV33_11465Help
Entry
FFWV33_11465      CDS       T05515                                 

Definition
(GenBank) secretion protein HlyD
  KO
K03543  membrane fusion protein, multidrug efflux system
Organism
ffa  Flavobacterium faecale
Brite
KEGG Orthology (KO) [BR:ffa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ffa02000]
    FFWV33_11465
Transporters [BR:ffa02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   FFWV33_11465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_3 HlyD_D23 Biotin_lipoyl_2 HlyD HlyD_2 Biotin_lipoyl Aconitase RapH_N TcpS
Motif
Other DBs
NCBI-ProteinID: AWG22085
UniProt: A0A2S1LEB4
LinkDB All DBs
Position
complement(2661588..2662667)
Genome map
AA seq 359 aa AA seqDB search
MEKKKTNTKFIIIVSALVILGGAYGIFKYMHSLAHEETDDAQIEKNMNPIIPRVSGYVDK
VYIKDNDFVKKGDTLFTIDSKEYRLKIDEATANLASAEGSFEVSKADIGSVMASVSVSDA
NVQSAGGNIQSAKIKLGLATNDFNRYSNLYKSHTITKQQYEQALAAKQEAENQIKILEQQ
QKASSFQKSVSQAKSKVSGKQTEVAAANIKRAKSMLETAQLNLTYTVITAAIDGQVSKID
IQPGQLVQPGQSLFYIINNTEAWVIANFKETQLNKMVAGQKVTLKVDAYPDYEFKATVTS
FSPATGSRFSILPPDNATGNFVKTIQRLPVKISIDKDNDAEKIKQLRPGMNVDVDVHIK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaaaaaaactaatactaaatttattatcatcgtttctgcacttgtgattttg
ggtggtgcttacggaatattcaaatatatgcactctctagctcatgaggaaacagatgat
gctcaaattgagaaaaatatgaacccaattattccaagagtttctggttatgttgacaaa
gtgtacatcaaagacaatgattttgtaaaaaaaggagacacattattcacgattgattcc
aaagagtaccgtttaaaaattgatgaagctactgcaaatttagcaagtgccgaaggaagt
tttgaagtttcaaaagcagatatcggaagtgttatggcaagtgtatctgtatcagatgct
aatgtacaatctgcgggtggaaacattcaatctgcaaaaattaaattgggtctagctacc
aacgattttaatcgttatagcaacttatacaaaagccacaccattacaaaacaacaatat
gagcaagcgttagcagctaaacaagaagctgagaaccaaatcaaaatattagaacaacag
caaaaagcctcttcttttcaaaaatcggtttctcaagctaaatctaaagtttctggtaaa
caaaccgaggtagcggctgctaatattaaaagagctaaatcaatgttggagactgctcag
ttaaatttaacatacactgtaattactgctgccattgatggtcaggtttcgaaaattgat
attcaaccaggacaattggttcagccaggacaatctcttttctatatcatcaacaacact
gaagcttgggtaattgccaatttcaaagaaacgcaattaaacaaaatggttgctggacaa
aaggtgactttaaaagtagatgcttacccagattatgagttcaaagcaactgttacttct
ttttctcctgcaacaggatctcgattctcaatcttgcctcctgacaacgctaccggaaat
ttcgtaaaaacaattcagagattacccgtaaaaattagcatcgacaaagataatgatgcc
gaaaaaattaaacaactacgtccaggaatgaatgtggatgtagatgtacacataaaataa

DBGET integrated database retrieval system