KEGG   Flavobacterium faecale: FFWV33_14065Help
Entry
FFWV33_14065      CDS       T05515                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ffa  Flavobacterium faecale
Pathway
ffa00620  Pyruvate metabolism
ffa00680  Methane metabolism
ffa01100  Metabolic pathways
ffa01120  Microbial metabolism in diverse environments
ffa01200  Carbon metabolism
Module
ffa_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ffa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    FFWV33_14065
  09102 Energy metabolism
   00680 Methane metabolism
    FFWV33_14065
Enzymes [BR:ffa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     FFWV33_14065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AWG22571
UniProt: A0A2S1LFY7
LinkDB All DBs
Position
complement(3298657..3301242)
Genome map
AA seq 861 aa AA seqDB search
MYINPKIERFNENVLSKYNIYNSVFITLPFDSIDNTGVMLPLFTDVCESGFKKQQTPKEI
MEFFSDKYLNSNSEKDKLDLMFRFIQYIERQIVLFDAVEDAAFSTVNNMEGRGSLRDIKE
KTDAKGKQEELIEFFKTFNVRTVLTAHPTQFYPGAVLGIINDLTEAIRGNNLLRIKQLLA
QLGKTPFIKNEKPNPFDEAVSLIWYLENVFYPTSSDMIHYLQKNVYPGHTVDNPIVKLGF
WPGGDRDGNPFVTTEITLKVADRLRTSILKCYYMEIRKLKRKLTFFNVDVLVAELENKLY
RSVFYSQGDIYITLEEFKAQLNKIRQIVIEQHQSLYLDDLEALIISVNLFGFHFATLDIR
QNSRIHDAVFKDVFDYYQKNDPAVFPANYYELSEADKFEVLSNAKGKLESKDFEEEMTRA
TIESIQAIKVIQVNNGEEGANRYIISNNESALNVMETLAMIHLTDWEKPTVDVIPLFESV
DDLLDAHNIMEKLYTNPMYAGHLKSRGNIQTIMLGFSDGTKDGGYLMANWSIYQAKEALT
AISRKYNVEVIFFDGRGGPPARGGGKTHKFYASLGPNIENKEIQITVQGQTISSNFGTLD
SCRYNLENLLSAGVTNQVFNKNKNIFAPEDKVVMDKLSRLGYEKYLNFKNHDKFIPYLEQ
MSTLKYYAKTNIGSRPSKRSKSAQLDFKDLRAIPFVGSWSQLKQNVPGFYGVGAALKHYE
EAGEWDKVQALYDNSMFFRTLLENSMMSLAKSFFPLTAYMKNDPEFGEFWQMIYDEFLDT
KRLLLKIAGHTELMENYPDGKASIEIRERIVLPLLTIQQYALLRINELNKAEVVDDALVK
IYEKIVMRSLFGNTNASRNSA
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atgtacataaatcctaaaattgaacgttttaacgaaaatgttctttctaaatacaatatt
tacaatagtgtttttataaccttaccattcgactctattgacaatacaggcgttatgctt
ccattgtttacagacgtttgcgagagtggatttaaaaagcaacagactcctaaagaaatt
atggagttcttttcggataagtacctaaattcaaatagtgagaaggataaattggatcta
atgttccgttttattcagtatatagaacgtcaaattgtattgtttgatgcagttgaagat
gctgctttttctacggttaataacatggaaggaagaggttctttgcgcgatataaaagag
aaaacagatgctaaaggaaagcaagaagaattgattgaatttttcaagactttcaatgtt
aggacagtgcttacggcacacccaacacaattttatcctggggccgttttaggtatcatc
aatgaccttactgaggcgataagaggtaataatttacttcgaattaaacaacttttggca
caattaggtaaaacaccttttatcaaaaacgaaaagccaaatccttttgatgaggctgta
agtttgatttggtatttagagaatgtattctatcctacttctagcgatatgattcattac
ctacaaaaaaatgtgtatccaggccatactgttgataatcctattgtaaaacttggtttc
tggccaggtggagaccgtgatggaaatccatttgtaaccacagagattactttgaaagta
gcagatcgattgagaacttcaatcttgaaatgttactatatggagattcgtaaactaaaa
agaaaattaacgttctttaatgttgatgttttggttgcggaacttgaaaataaattatac
cgttctgttttctattctcaaggggatatttatatcactttagaggagtttaaagcacaa
ttgaataaaataagacagattgttattgagcaacatcaatccttgtatttggatgatttg
gaagctttgatcattagtgttaatttgtttggtttccattttgcaactttagatatccgt
caaaacagtagaattcatgacgctgtatttaaagatgtttttgattactaccaaaaaaat
gacccagctgtttttccagctaattactacgaattgtcagaagcagataaatttgaagta
ttatcgaatgctaaaggaaaattagaatcgaaagattttgaagaagaaatgacacgtgca
actatcgagtctattcaagcaatcaaggtaattcaagtgaacaatggtgaagaaggagca
aaccgttacatcattagtaataacgaaagtgctttgaatgtaatggaaacattagccatg
atccatttaacagattgggaaaaaccaactgtagatgttattccgctttttgaatcagta
gacgatttacttgatgcgcacaacattatggagaagttatacaccaatccaatgtatgca
ggccacttgaagagtagaggtaacattcaaacgatcatgttaggcttctcagacggaaca
aaagatggtggctacttaatggctaactggagtatttatcaagcaaaagaagctttgact
gccatttctagaaaatacaatgttgaagttatcttttttgacggacgtggtgggccacct
gcacgtggaggaggaaaaacacataaattctatgcgtcactaggaccaaacatcgagaac
aaagagatacaaattacagttcaaggacaaactattagttcaaatttcggaacattagat
tcttgtcgttataacctagaaaatttattgagtgcaggtgttacaaaccaagttttcaat
aaaaacaaaaatatctttgctccagaggacaaagtagtgatggataaattatctcgtctt
ggttatgagaaatatttaaacttcaaaaatcacgacaaatttattccatatttggagcaa
atgagtacgttgaaatactatgcgaaaaccaatattggtagccgaccttcaaaaagaagt
aaatcagcacaattggatttcaaagatttaagagcaattccttttgttggatcttggagc
caattaaaacagaatgtacctggtttttatggtgtaggtgctgcgcttaagcattatgaa
gaagctggtgaatgggacaaagttcaagcattgtatgacaactctatgttctttagaacc
ttgttagagaatagtatgatgtcattggctaaatcatttttccctttgactgcttacatg
aaaaatgatcctgaatttggtgagttttggcaaatgatctacgatgaattcttagataca
aaacgtttattattgaagattgcaggtcataccgaattgatggaaaactatcctgatggt
aaagcttcaatcgagattagagagcgtatcgtgttgccattgttaacaatacaacaatat
gctttgcttagaattaacgaattgaacaaagctgaagttgtagatgatgcactagttaag
atttatgaaaaaatcgttatgcgatctcttttcggaaatacaaatgcaagtagaaactca
gcataa

DBGET integrated database retrieval system