KEGG   Fervidicoccus fontis: FFONT_0196Help
Entry
FFONT_0196        CDS       T01936                                 

Definition
(GenBank) aldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
ffo  Fervidicoccus fontis
Pathway
ffo00030  Pentose phosphate pathway
ffo01100  Metabolic pathways
ffo01120  Microbial metabolism in diverse environments
ffo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ffo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    FFONT_0196
Enzymes [BR:ffo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     FFONT_0196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AFH42187
UniProt: H9ZZN0
LinkDB All DBs
Position
185759..187576
Genome map
AA seq 605 aa AA seqDB search
MYGNWGKILRVNLTEKEIKVDTYEEEVARKWLGSRGLGIYLLLKEMDPKVDPLGPENKLI
IAAGPLTGTPAPTGGRYNVITKSPLTGYITFSNSGGYFGAELKKAGYDAIVVEGASDKPV
YLYINDEHVELRDASHLWGKKMSETEAIIKKELNEEHLRVAGIGPAGENLVRFANIMNDV
HRAAGRGGPGAVMGSKKLKAIAVKGSKEIPVADKNKFMNVVREKVNKIRNDPVGGGGLPK
YGTAVLVNIINENGLYPTRNFQTGVFQYAYEQSGEALAEKYLVRNNPCFACPIGCGRVTK
LPTVGQTEGPEYETIYALGSTLGINDLATIVETNHLADEYGLDTISLGGTIATAMELYEK
GYIKEEDLQKGPPLRWGNTEVLHYYIEKIVKKEGFGKELAEGGYRLAKKYNAEQYFMGVK
KLELPAYDPRGAEGHGLGYATNNRGGCHVKNYMISPEILGYPYKMDPHDISDAKINMLLL
FQHLTAIIDSAGLCLFTTFGLGADDYTDLLNAALGWNLKTEDYLKIGERIWNAERLFNLK
AGLDPLKEDTLPKRFLEEPMPEGPNKGRVVRLKEMLPRYYKMRGWTEDGRIPREKLKELE
LEQFA
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtatgggaattggggtaagattttaagggtaaatcttactgagaaagagataaaagtt
gatacttatgaagaggaagtagctaggaaatggctcggcagtagaggacttggaatttat
ctacttctaaaagaaatggatccgaaggttgatccgctcggtccagaaaacaagcttatt
attgctgcaggaccgttaacagggacaccggctcctactggaggtaggtacaacgttata
accaagagtcctttaacaggatacataacgttctctaattcaggagggtactttggagct
gagcttaaaaaggctggatatgatgcgattgtcgttgaaggagcctcagacaagcccgtt
tatctatacataaatgacgaacatgtagagttgagggacgcatctcatctgtggggcaaa
aaaatgagcgaaacagaggcaataataaagaaggagctgaatgaggaacacttgagggtt
gcaggaattggcccagctggtgaaaatctggtgagatttgcgaacattatgaatgacgtg
cacagggcagctggaagaggagggccaggggcagttatgggtagcaaaaagctcaaggcc
attgctgttaagggtagcaaggaaatccccgtagcagataagaacaagtttatgaatgtc
gtgagggaaaaggtcaacaaaattagaaatgaccctgtaggcggaggaggtcttccaaag
tacgggaccgcagttctcgtcaatataataaacgagaatggtctatacccaacaaggaac
ttccagacaggagttttccaatatgcatatgagcagagcggagaagcgcttgcagagaaa
tatcttgtaaggaataatccgtgctttgcatgcccaataggatgcggaagagttacaaag
ctcccaacagttggtcaaacagaaggtccagaatatgagacgatctatgctttaggcagc
acgttgggaataaatgatcttgccacaatagttgaaaccaatcatttagcggatgaatac
ggccttgatactatatctcttggagggaccattgctacagctatggagctatatgaaaaa
ggatatattaaggaggaagatttacagaaaggtcctccgcttagatggggcaacaccgaa
gtacttcactattatattgaaaaaattgtgaagaaagaaggttttggaaaagagctcgca
gaaggaggatataggttagcaaagaaatataatgccgagcagtattttatgggagtaaag
aaattggagcttccagcatatgatcccagaggggcagagggacatggcttggggtatgca
acgaataatagaggaggatgccatgtaaagaactacatgattagccctgaaattctggga
tatccgtacaagatggatccccacgatattagcgatgcaaaaataaacatgttgcttcta
ttccagcacctcactgcaattattgactctgcaggtctctgcctctttacgacattcggg
ctcggtgcggatgattataccgatctactcaatgctgcacttggatggaacctgaaaacg
gaagattatttgaagatcggagagaggatttggaacgcagaaagactattcaacctcaaa
gcaggtctcgatccgctaaaagaggatacattgccaaagaggttcttagaagaacctatg
cctgaaggtccaaacaaaggaagagtcgtcaggttaaaagaaatgcttccgagatactac
aagatgagaggatggaccgaagacgggaggattccaagagaaaagcttaaggaattggaa
ttggagcagtttgcttaa

DBGET integrated database retrieval system