KEGG   Fimbriimonas ginsengisoli: OP10G_0698Help
Entry
OP10G_0698        CDS       T03038                                 

Definition
(GenBank) beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
fgi  Fimbriimonas ginsengisoli
Pathway
fgi00052  Galactose metabolism
fgi00511  Other glycan degradation
fgi00600  Sphingolipid metabolism
fgi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fgi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    OP10G_0698
  Lipid metabolism
   00600 Sphingolipid metabolism
    OP10G_0698
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    OP10G_0698
Enzymes [BR:fgi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     OP10G_0698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Glyco_hydro_2_N DUF4982 Glyco_hydro_2
Motif
Other DBs
NCBI-ProteinID: AIE84066
UniProt: A0A068NKT3
LinkDB All DBs
Position
725611..728397
Genome map
AA seq 928 aa AA seqDB search
MNPVFVPLRRLFPLLALLLLAATSGWASPRLRIRFDDGWRFRRDADPKSGGEMGPLSWQW
KPADRDLDLQTLPSDIDSGPWKPTRLGRNELRNGIRFGWFRADLGSNPLDREKVLHFESV
DDNAVVFVNGIRLKRQDGYGTPFDVPVFRAWSASGPNRLVVLVENTGGWGGINGSVTFAK
PPPPESLPAEAATGFSDKAWRTVHLPHDYVVEGTFKQGENVSHGSLPRPTAWYRKTFTIP
PSYRGKRVWIDFDGVYRNSTVYLNGRKLGHESSGYIGFRYDLTDRLQYGKPNVLAVRVDP
TKDEGWWYEGAGIYRHVWLNVTSPVHVVPDGTFVTSNVGAGRASLTISTSIANDSSHPTR
VVLTSEIYDPAGHRVATIRKVDLIEAGKSVTVNQHSDVVKPTLWSLESPRRYQLKTSIQA
VGDPTYHTIKSDEVNTPFGIRTIRFDKDKGFFLNGKPVKLKGTCNHQDHAGVGTAMPDGL
LEWRIQRLKSMGSNAYRCSHNPPAAELLDACDRLGMLVMDETRHLGDATQPKSPRGTTAD
DLSELKRLVLRDRNHPSVIMWSLFNEEPLQGSPEGAAIYEKMVAAVRKLDPTRPCTGAAN
GGYGSGIQLVSELFGFNYNIGAYDNFHRRFPNQPMYGSETASTVSTRGIYANDTVRGYVS
AYDVNHPAWAETAEHAWKPIAERPWMAGGFVWTGFDYKGEPTPYGWPCVNSHFGILDICG
FPKDNFYYYKAWWGDKPVVHLLPHWNWPGKEGQKINVWVQSNADRVELLVNGRSVGSKPV
PRFEHAEWDVPYEPGMLEARGYRGNKLIASDRIDTTGAPAAIRLKTTRSRLLADEEDLSP
VEVEIVDARGRVVPTADNMVKFSISGPGHVAGVGNGDPSSHEPDKASKRHAFNGLCMALV
QATNRPGRIVVTATSPGLKGASLVLTSH
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgaatccagttttcgttccgcttcgccgcctctttccgctgctcgccctcctgctcctc
gccgccacctcaggctgggcgtcgccccgcctccggatccggttcgacgacgggtggcgt
ttccgtagggacgccgatcccaagtcaggaggggagatggggccactttcctggcagtgg
aagccggccgaccgtgacctggatttacagacccttccgtccgacatcgattccggaccg
tggaagccgacgcggttgggacggaacgagctccggaacggaatccgtttcgggtggttc
cgagccgatctgggttcgaatcctctcgatcgggaaaaggtgctgcatttcgagtcggtc
gacgacaacgcagtggtctttgtcaacggaatccggctgaagaggcaggacgggtacggg
acgccgttcgacgttccggtcttcagagcctggagcgcttctggaccgaaccggctcgtg
gtcctcgtcgagaatacgggcggatggggcgggatcaacggcagcgtcaccttcgccaag
ccgccgcctcccgagtctttgcctgctgaagccgcgactgggttctcggacaaagcttgg
cggacggtgcaccttccccacgactacgtggtggagggaacgttcaaacaaggcgagaac
gtgtcgcacggctcgctgcctaggccgaccgcctggtatcggaagacctttacgattccc
ccttcctaccgcggcaagagggtttggatcgacttcgacggggtgtaccgaaacagcacc
gtctatctcaacggccgaaagctcgggcacgaatccagcggctacatcggattccgctac
gacctcaccgaccggctgcaatacggaaagccgaacgtcttggccgtccgagtcgatccg
acgaaggacgagggatggtggtacgagggcgcgggcatctaccggcacgtctggctaaac
gtgacatcgccggtgcatgtcgtaccggacggaacgtttgtgacgtcgaacgttggcgcc
gggcgggcgtctttgactatctcgacctccattgcaaatgactctagccatccgacaagg
gtggtgttaacctcggagatctacgatccggccggacatcgagtcgcaacaatccgaaag
gtcgacttgatcgaggcgggcaagagtgtcacggtcaaccagcattcagatgtagtcaag
cccacgctctggtccttagaaagcccaaggcgataccagcttaagacctcgatccaggca
gtgggcgatccaacgtatcacaccatcaagagcgacgaggtcaacactcccttcggtatc
cggaccatccggttcgacaaagacaagggattcttcctgaacggcaagccggtgaagctg
aaaggcacctgcaaccaccaggaccatgccggagtcggaaccgcgatgccggacgggctg
ctcgagtggcgaatccagcggttgaaatcgatgggctcgaacgcctatcgctgctcgcac
aacccgccggcagcggagttgctcgacgcctgcgaccggctcggaatgctcgtcatggac
gaaacccgccatctcggcgacgcgacccaaccgaagtcgccgcgaggcaccacggccgac
gacctatccgagctcaagcggctcgtcctacgcgaccgaaaccacccgagcgtgatcatg
tggtcgctcttcaacgaggagccgcttcaaggatcgccggaaggcgcggctatctacgag
aagatggttgccgccgttcggaagttggatccgacgaggccgtgcaccggcgcggcgaac
ggtggatacggcagcggaatccaactcgtgagcgagttattcggcttcaactacaacatc
ggcgcctacgacaacttccatcggcgcttcccgaaccagccgatgtacggcagtgaaacg
gcgagcaccgtcagcacccgcggaatctacgccaacgacaccgtccgcggctacgtgagc
gcctatgacgtgaaccatccggcgtgggccgagaccgccgagcatgcctggaaaccgatc
gccgagcgcccttggatggccggcggcttcgtctggaccgggttcgactacaaaggtgag
ccgacgccgtacggttggccatgcgtcaattcgcacttcggcatcctcgacatctgcgga
ttccccaaggacaacttctactattacaaggcctggtggggagataagccggtcgtgcac
ctgctgccgcactggaactggcccgggaaagagggacaaaagatcaacgtctgggttcaa
agcaacgcggaccgggtggaactgcttgtaaacggccggtctgttggttcgaagccggtg
ccgaggttcgagcacgccgagtgggatgttccttacgagccggggatgctggaggctcgg
ggataccggggaaacaagctgatcgccagcgaccggatcgacaccaccggtgcgccggcc
gcgatccgattgaagaccacccgatcgcggctcttggccgacgaggaggatctatcgccg
gtcgaagtggagatcgtcgatgcccgcgggcgcgtcgtgccgaccgcggacaacatggtc
aagttctcgatctcgggtcccgggcatgtcgcgggcgtcggcaacggcgacccaagcagt
cacgagccggacaaagcatcgaagcgccacgccttcaacggtctctgcatggcgttagtg
caggccaccaaccggcccggccggatcgtggtcaccgccacctcccccggcctgaagggc
gcgtcgttggtcttgacgagccactag

DBGET integrated database retrieval system