KEGG   Fimbriimonas ginsengisoli: OP10G_4577Help
Entry
OP10G_4577        CDS       T03038                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
fgi  Fimbriimonas ginsengisoli
Brite
Enzymes [BR:fgi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     OP10G_4577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N HOIP-UBA
Motif
Other DBs
NCBI-ProteinID: AIE87945
UniProt: A0A068NY95
LinkDB All DBs
Position
4973133..4973834
Genome map
AA seq 233 aa AA seqDB search
MIASAAAGVTAVAGAPLNALARTKEIRKNMEPKLVHVPTEADIQKALKTAPKGISEATHK
AHLTLWQGYANKTNEIRKALAEMEVDPAKANQIYSQMRALKVNYAFALGGYKNHNVYFDT
IGGDGGAPSGDVATLINEAYGSYENWAKDIKTTGIAGRGWAYLAYDRDEQRVFNFIGDAQ
DTFPQWNCELILALDVYEHAYFLDFQTARAKYIDAWLNCVDWNAVNARLGKAK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgcaagcgcggcggcgggagtgacggcagtggccggagccccgctgaacgccctc
gcgcggacgaaggagattcggaaaaatatggaacccaaactcgtgcacgtgccgactgag
gccgacatccagaaagcgctgaagaccgcccccaaggggatcagcgaggcgacccacaag
gcgcacctcaccctctggcagggatatgccaacaagaccaacgagatccgcaaggcgctc
gccgagatggaagtcgaccccgccaaggcgaaccagatctatagccagatgcgcgccctc
aaggtgaactacgcgttcgcgctgggcggctacaagaatcacaacgtctacttcgacacc
atcggtggcgacggcggcgcgccctccggtgacgtggcgaccctgatcaacgaggcttac
ggctcgtacgagaattgggccaaggatatcaagacgaccggcatcgccggccgcggctgg
gcttacctggcctacgaccgcgacgagcagcgggtcttcaacttcatcggcgacgcccag
gacacgttcccgcagtggaactgcgagctcatcctcgcccttgacgtctacgagcacgcc
tacttcctcgacttccaaaccgcccgcgccaagtacatcgacgcctggctcaactgcgtc
gactggaacgccgtcaacgcccgcctcggtaaggccaagtaa

DBGET integrated database retrieval system