KEGG   Fimbriimonas ginsengisoli: OP10G_4644Help
Entry
OP10G_4644        CDS       T03038                                 

Definition
(GenBank) Alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
fgi  Fimbriimonas ginsengisoli
Pathway
fgi00500  Starch and sucrose metabolism
fgi01100  Metabolic pathways
fgi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    OP10G_4644
Enzymes [BR:fgi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     OP10G_4644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase Capsule_synth
Motif
Other DBs
NCBI-ProteinID: AIE88012
UniProt: A0A068NXE7
LinkDB All DBs
Position
complement(5042592..5045156)
Genome map
AA seq 854 aa AA seqDB search
MKHPKFSHAFEVTTEFPEALAPLKELASNYRWTWDHETRDLYRSIDKERWDNSDHNPILF
LNSLGRERLERLAADGYFITRLNRAVSRLREYLGAETWFGKTYPELADNTKIAYFCAEFG
ISEGLPIYSGGLGVLAGDHLKAASDLGIPLVGVGLLYNRGYFRQRLNHDGWQQEVYPQYD
FYQMPLTLIRGEDGQPLRIDVEFPDRTVTCQVWRAEVGRVSLFLMDSNVLENQAADQGIT
DNLYGGDEDMRIRQEMILGIGGMKALRAIGINPTVCHMNEGHAAFLSIERIRQFMQDHGC
DFRTARQVIVGGNIFTTHTPVPAGFDLFNPPLLERYMGKSVAETGLPFEEFVKLGRVDPE
NQGEAFNMAVLAMENANRVNSVSKLHGEVTRGMFSSRWPGYPEDEVPVGAVTNGIHTMTW
VSKRMAEMFDNYLDPAWRRNPENPDLWAGIDDIPDEELWGAIEHQRGDLIRFIRRRLQND
LERRMAGGLDFGTINGILDPRILTIGFARRFATYKRASLMLTDRDRLKSILYHSERPVQI
VISGKSHPRDDGGKRIIQDLVQFMSSGGARTRMVFLEDYDMRVARQLVQGVDLWLNNPRR
PHEASGTSGMKVVPNGGLNLSILDGWWDEGYEPGLGWAIGDRTQLGDEGHQDWLDSRALY
HAIEHEVAPMFYHRVENGVPRGWVQMVKRSIQKLGPTFSTNRMVRDYARDYYVPAARTYH
TMADGTLDKAREALAWRDRVRTNWGAVRVAEVRDGAETANPLGRSFEVTAAVEMGPLAPG
DVSVQAVVGKVGPNRELQNAQITELLPVGADGNRQLFKGTITCDVPGYQGYTVRVVPKHD
DVAIPSELSLIAWE
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgaagcatccgaagttttcccatgctttcgaagtcaccaccgaattcccggaggcgctg
gctccgctaaaggagcttgcgagcaactaccggtggacttgggaccacgagacgcgcgat
ctgtatcggtcgatcgacaaggagcggtgggataattccgaccacaacccgatcctgttt
ctgaacagcctcggacgggagcgtctggagcgtctggcggccgacgggtacttcatcacc
cggcttaatcgggcggttagccggcttcgggagtatctcggcgcggagacctggttcggg
aagacgtatcccgagctggcggataacaccaagatcgcttacttctgcgcggagttcggg
atctcggaagggctgccgatctattccggcggtctcggtgtgttggcgggggaccacctg
aaggcggcgagcgatctcggaattccgctcgtcggagtcggcctcctttataaccgtggg
tacttcaggcagcggctaaaccacgacggctggcagcaggaggtttatcctcaatacgac
ttctatcagatgccgctcacgctgatccggggcgaggatggacagccgctacggatcgac
gtcgagtttccggaccggacagtaacctgtcaggtttggcgcgccgaagtcggccgggtt
tcgctgttcctgatggacagcaatgtgctggagaatcaggccgcggaccaggggatcacc
gacaacctgtacggcggcgatgaagatatgcggatccgccaagagatgatcctggggatc
ggcggtatgaaggcgctccgcgccatcggcatcaaccccacggtgtgccatatgaacgag
gggcacgcggcgttcctttcgatcgaacggattcggcagtttatgcaggatcacggctgc
gatttccgcaccgcgcggcaggtcatcgtcggtggaaacatttttaccacccatacaccg
gtcccggccggattcgacctgttcaaccccccgctgttggagcggtacatgggcaagtcg
gtggctgagacggggctcccgtttgaggagtttgtcaagctcggccgggttgacccggag
aaccagggagaggcgttcaacatggcggtgctcgcgatggagaatgccaaccgcgtgaac
tcggtttccaagctccatggcgaggtaacccgcggcatgttctcctctcgatggccgggg
tacccggaggacgaggtgccggtgggcgcggtgacgaacggcatccacacgatgacgtgg
gtcagcaagcggatggccgagatgttcgacaactacctcgacccggcatggcggcgaaat
ccggagaacccggatctgtgggcggggatcgacgatattccggacgaagagctttggggg
gcgatcgagcaccagcggggggacctgatccggtttatccggcgacgcctgcagaacgac
ctggagcggcgcatggcgggcgggttggatttcggaacgatcaacggcatcctagatccg
cggattctcacgatcggcttcgcccgccggtttgcgacttataagcgggcctcgctgatg
cttaccgaccgggaccgcttgaagagcatcctttaccattcggagcggccggtgcagatc
gttatctccggtaagagccaccctcgggacgacggtgggaagcggattatccaggacctg
gtgcagttcatgagcagcgggggcgctcgcactcggatggtgttcctcgaggattacgac
atgcgcgtagcccgtcagcttgttcagggggtcgacctgtggctgaacaacccgcggcgc
ccgcatgaggcgtcgggtacgagcggcatgaaggtcgtgcccaacggtgggctgaacctg
tcgattctggacgggtggtgggacgaggggtacgaacctggcctgggatgggcgatcggc
gaccggacgcagttgggggacgaggggcatcaagactggctggatagccgggcgctgtac
catgccatcgagcatgaggtcgcgccgatgttctaccaccgggtcgaaaacggcgttcct
cgcggctgggtgcagatggtaaagcgctcgatccaaaagcttggcccgactttctcgacc
aaccggatggtgcgtgattacgcgcgagactactacgtgccagcggcgaggacctaccac
acgatggcggatgggacgctcgacaaggcgcgcgaggcgctcgcttggcgcgaccgggtc
cggaccaactggggcgcggtgcgggtagccgaggtgcgcgacggggcggagacggccaac
ccgcttgggcgctcctttgaggtgacggcggcggtggagatgggtccgctcgcgccggga
gacgtcagtgttcaggcggtggtagggaaagtcggcccgaatcgggagcttcagaacgcg
cagattaccgagctgcttccggtgggggcggatggcaatcgtcagctattcaaggggacg
attacctgcgacgtgccggggtatcagggttacacggttcgcgtggtgcctaagcacgac
gacgtggcaatcccgagcgagctaagcctgatcgcctgggagtag

DBGET integrated database retrieval system